KEGG   Burkholderia gladioli ATCC 10248: BM43_5691Help
Entry
BM43_5691         CDS       T03826                                 

Definition
(GenBank) AMP-binding enzyme family protein
Organism
bgo  Burkholderia gladioli ATCC 10248
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:1989936..1991669
Genome map
AA seq 577 aa AA seqDB search
MIDAILAAAEHPDTHRPALLAVIEDDGQERSLDYEVFAHRALAACAALHEMGVRQRDLVI
LALPTSVDHLLALAGCVLLGAMPCTVPLPGRLATDSSKNQLYLACRTFSPRLVIAPDLLA
QGFRDDLANARTHVIAMSELRLAAQAGGTPVIGRRGPHEAHHVQLTSGSTGRPKAAVLTH
RNVLDNSYGIGGSVGYDTARGDASGSWLPLFHDLGLLTLLSNIAYQSPILLMQPSSFIRN
PLGWLKRIAAFGATTTASPTFGLQYCVRRFREASMREVDLSRLRNIFIGAERVDEACLHD
FADRFGPYGLSRSALQPCYGMAESTLATTMHDATRNYDPRSLAYVVPDRIDSEAVIKQGY
ALPARADSHLTESILSMGRPIPGMELRVIAPAGTQAHEREVGEIHIRGTSIMSDYLPAEG
QTERHDRDSWFATGDLGYLLDGELYVLGRKKEIIIIRGNNYFPHEIEDVVAAHPGLSEAA
IVAAGVFDEVQGTENIVLFIESETVDLMGELHRALQAALREAFGFGAQAIVFVRNGSLPR
TSSGKLQRLKCRDLYVQGRLAVVAEPEAARLEEPAAL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgcgattctcgcggccgccgagcacccggatacgcatcgtccggcgctcctg
gccgtcatcgaggacgacggccaggagcgcagcctagactacgaggtgttcgcgcaccgc
gcgctggccgcctgcgcggccctgcacgagatgggcgtgcgccagcgcgacctggtgatc
ctggcgctgccgacctcggtcgaccatctgctggcgctagccggctgcgtgctgctgggc
gcgatgccctgcaccgtgccgctgccggggcgcctggccaccgattcctcgaagaaccag
ctctatctcgcctgccgaaccttctcgccgcgcctggtgatcgctcccgacctgctcgcg
cagggcttccgcgacgatctcgcgaacgcgcgcacccacgtgatcgcgatgtcggagctg
cggctggccgcccaggctggcggcacgcccgtgatcggccggcgcggcccgcacgaggcg
catcacgtgcagctcacctcgggttcgaccggccgccccaaggccgccgtgctgacccat
cgcaacgtgctcgacaacagttacggcatcggcggctcggtcggctacgacaccgcgcgc
ggcgatgccagcggtagctggctgccgctgttccacgatctcggcctgctcaccctgctg
tcgaacatcgcctaccagtcgccgatcctgctgatgcagccctccagcttcatccgcaac
ccgctcggctggctcaagcggatcgccgccttcggcgcgaccaccaccgcctcgccgacc
ttcggcctgcaatactgcgtgcggcgcttccgcgaggcctcgatgcgcgaggtcgacctg
agccgcctgcgcaacatcttcatcggcgcggaacgcgtcgacgaggcctgcctgcacgat
ttcgcggaccggttcggcccctacgggctgtcgcgctcggcgctgcagccctgctacggc
atggccgagtcgacgctggccaccaccatgcacgacgccacgcgcaactacgatccgcgc
tcgcttgcctacgtggtgccggaccgcatcgattcggaagccgtgatcaagcagggctac
gcgctgccggcgcgcgccgacagccatctcaccgagagcatcctgtcgatgggccgcccg
atccccggcatggagctgcgggtgatcgcgccggccggcacgcaggcgcacgagcgcgag
gtgggcgagatccacatccgcggcacctcgatcatgtccgactacctgccggccgaaggc
cagaccgagcggcacgaccgcgacagctggttcgccaccggcgacctcggctacctgctc
gacggcgagctctacgtgctcggtcgcaagaaggaaatcatcatcatccgcggcaacaac
tacttcccgcacgagatcgaagacgtggtggccgcgcatccgggcctgagcgaggcggcg
atcgtcgccgccggcgtgttcgacgaggtgcagggcaccgagaacatcgtgctgttcatc
gaatccgagacggtcgacctgatgggcgagttgcaccgcgcgctgcaggccgcgctgcgc
gaggccttcggcttcggtgcgcaggccatcgtgttcgtcaggaacggcagcctgccgcgc
accagcagcggcaagctgcagcgcctcaagtgccgcgatctctacgtgcagggccggctc
gcggtggtggccgagcccgaggccgcgcgcctcgaggagccggccgcgctctga

DBGET integrated database retrieval system