KEGG   Burkholderia gladioli ATCC 10248: BM43_747Help
Entry
BM43_747          CDS       T03826                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase Fe
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bgo  Burkholderia gladioli ATCC 10248
Brite
Enzymes [BR:bgo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BM43_747 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(805995..806573)
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYAEDALAPHISAETIQFHYGKHHQTYVTNLNNLIPGTEFENLSLEEIVKKS
SGGIFNNAAQIWNHTFFWNSLSPQGGGAPTGALGDAINAKWGSFDAFKEAFTKTAVGTFG
SGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTIDVWEHAYYIDYRNARPKFVEAFWN
IVNWDFAAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctcatacgctcccgccgctgccgtacgctgaagacgcgctcgctccgcacatttcg
gcagagacgatccagttccactacggcaagcaccaccagacctatgtgacgaacctgaac
aacctgatcccgggcaccgagttcgagaacctctcgctcgaggagatcgtgaagaagtcg
tcgggcggtattttcaacaacgccgcgcaaatctggaatcacaccttcttctggaacagc
ctctcgccgcagggcggcggtgcgccgaccggcgcgctgggcgacgcgatcaacgccaag
tggggttcgttcgacgccttcaaggaagccttcacgaagacggccgtgggcacctttggt
tcgggctgggcctggctggtgaagaaggccgacggctcgctcgacctggtctcgaccagc
aacgccgccacgccgctgaccaccgacgccaagccgctgctgacgatcgacgtgtgggaa
cacgcctactacatcgactaccgcaacgcgcgtccgaagttcgtcgaagcgttctggaac
atcgtgaactgggacttcgccgcgaagaacttcgcgtaa

DBGET integrated database retrieval system