KEGG   Burkholderia glumae PG1: BGL_2c01040Help
Entry
BGL_2c01040       CDS       T03632                                 

Definition
(GenBank) non-ribosomal peptide synthase
Organism
bgp  Burkholderia glumae PG1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(120466..125862)
Genome map
AA seq 1798 aa AA seqDB search
MNAFEATMSRFDHLQNFGQCLRHWATVKPHDTAFRFLTDGVVEAPRLSFAELDRRATAIA
SRLARECPRGEPVLLLYRPGLDFIAAFFGCLYAGCAAVPAYPPSGRATRRNRLAAIIADC
GAGAILTSDDLVEAIREEIAQAEAPVRADVIGTDALLAAPGGTLDTSEAMLPASHLAFLQ
YTSGSTGRPKGVRVTHRNLLANERAIREGFRHGPDTVFVGWCPLYHDMGLIGNVLQPVYL
GIPSVLMSPFAFLQQPLKWLRAISTYGATTSGGPNFAYELCATRIAEADKAGLDLSSWRV
AFNGAEPIRASTLDRFAAAFADYGFDAGAMFPCYGMAETTLFVSGAVPGAGALTRRVDAL
ALQAGRCADAVDGQPAVELVSSGRVGGDQQVRIVDPHSLRASGPGEIGEIWVRGGSVADG
YWNREDDTRAQFDARIAGEDSPPFLRTGDLGLLDGGELYVTGRLKELIIIRGRNHYPTDI
EQTVEQSSADFRAGCGAAFAIDGEGGERLVVVQEIQRAVRKSLDAEEAGRRAAAAVAAAH
GIPLHELVLVQAGVVPKTSSGKNQRTLVRQHYLEGKLPVLARTQPGAGAGAATVTTAVTP
AAPGGSVDDLSERVIVAMLGAAGAARPEARAASPLALGLDSLALVDLQTRLARELGIAVE
LDDLMDERPVAELARDLAARAFDGGGASGGEAPAPALPPASDPTALTPYQEAIWTAQLWD
PALPCFNLVLPLRVRAPLSAGHVREALAALTVAHPGLASRFVQDGNGDVRQQPAAATAGL
LDVINCAGQSDDALRARIVASASAPIDLAGGPVFRAELLSRAPDDHLLVLIAHHLVADLG
SLQTVLADFAEFHACLAGDRPLPARAIAAAGVAVPDYRTRLAALLHGPRAEADRQYWAAR
LATPIEPLALPLALPGEAPAGVVAGSGMSVDVDLDAALAGALDALCASRRVTRNMALLAA
FFAFLHRYTAQRDVAVVTPAAVRPGGEFDDWVGYGVNLLVIREAVDGELPFAALLAAMKQ
TVAGALAHRTTPFIDLARRFARRDDDVRHPFSRVLFAYHNLNRLPQAADLLAGTAGQPLA
VGGLALESFPVPTPAAQTDLALVAIQAGERLVLRFEYDATLASRAAIERMAAHFRTLLGA
LLAQPDQPVARAALLDPAERERQLVTWNRRPLAAPATGPAASAAMNLAADYATVHAMIDA
MSRRVPERLAVRTDTEQLDYAQLRRDSDALAAALHARGVRHGDVVGVGLPRDVRLPIMLL
AIWKAGAAYLPIDLGVPAERVRQMLDDAQAALIVAPAALRGALGDDGRAWVTPEALAADA
AAGESPAAPESRAGRDSLAYVLFTSGSTGRPKGVEIEHRNVLSLLAWIGARYSAGELAAV
FAGTSIAFDISVFELFGPLAHGGCVVIGENPATPPATPVSLLNTVPSAAAALLETGALPA
SVVTVNLAGEPLRQSLVDALYARGTIGKVYDLYGPTEDTVYSTAVLREPGGFDTIGTPLP
GKRVYLLDAHGEPVPVGVAGELFLAGDGQARGYRNRPDLTGRAFVAVPALADLETRLYRT
GDIGRLLPDGRIVLSGRRDHQVKIRGHRVELGEIEAVLLRQPGVRDAVVVQTRHAERSGD
DGDSRDALLVAYLAVGDAADEAVGTPPRPVVTVEAVREYAAASLPSYMRPTGYVLLDALP
RNPSGKVDRAALPRFDPVAQDDAAAPVSDTQRAVLAIWEAVLGFQGFGIHANLFELGGHS
LQVIQIIARCRERFGVEISLAKVLERTTVADLAAYVTLLAARSGAADEPGGVREEVLF
NT seq 5397 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcctttgaagccacgatgagtcggttcgatcatctgcagaattttggccagtgc
ctgcgtcactgggcaacggtcaagccgcacgacaccgcgttccggttcctgaccgacggc
gtcgtcgaggcaccgcgactgagcttcgccgaactcgaccggcgcgccaccgcgatcgcc
tcccgcctcgcgcgcgaatgcccgcgcggcgagcccgtgctgctgctctatcggcccggg
ctcgacttcatcgccgcgttcttcggctgcctctacgcgggctgcgcggcggtgccggcc
tatccgccgtcgggtcgcgccacgcgccgcaaccggctcgccgcgatcatcgccgactgc
ggggccggcgcgatcctgacgagcgacgacctggtcgaggcgatccgcgaggagatcgcg
caggccgaggcaccggtgcgcgccgatgtgatcggcaccgacgcgctgctggccgcgccg
ggcgggacgctcgacacgagcgaggcgatgctgcccgccagccacctggcgttcctgcag
tacacctcgggctcgaccggccgccccaagggggtgcgcgtcacgcaccgcaacctgctc
gccaacgagcgcgcgatccgcgagggcttccgccacggcccggacacggtgttcgtcggc
tggtgcccgctgtatcacgacatgggcctgatcggcaacgtgctgcagcccgtctacctt
ggcatcccgtcggtgctgatgtcgccgttcgcgttcctgcagcagccgctcaagtggctg
cgcgcgatctcgacctatggggcgaccaccagcggcggcccgaacttcgcctacgaactc
tgcgcgacgcgcatcgccgaggccgacaaggccgggctcgacctgtcctcgtggcgcgtc
gcgttcaacggcgccgagccgatccgcgcctcgacgctcgacaggttcgcggccgcgttc
gccgactacggcttcgacgcgggcgcgatgttcccgtgctacgggatggccgagaccacg
ctgttcgtgtcgggcgcggtgcccggtgccggcgcgctcacgcgccgcgtcgacgcgctc
gcgctgcaggccgggcgctgcgccgacgcggtcgacgggcagcccgccgtcgagctggtg
agttcggggcgcgtgggcggcgaccagcaggtgcgcatcgtcgatccgcacagcctgcgc
gcgagcggccccggcgagatcggcgagatctgggtgcgcggcggcagtgtcgccgacggc
tactggaaccgcgaggacgacacgcgcgcgcagttcgacgcgcgcatcgccggcgaggac
tcgccgccgttcctgcgcaccggcgatctcggcctgctcgacggcggcgaactctacgtg
acgggccggctcaaggagctgatcatcatccgcgggcgcaaccactacccgaccgacatc
gagcagaccgtcgagcagagcagcgccgacttccgcgccggctgcggcgcggcattcgcg
atcgacggcgagggcggcgagcgcctggtggtggtgcaggagatccagcgcgccgtgcgc
aagtcgctcgacgccgaggaggccgggcggcgcgccgccgccgccgtggccgccgcgcac
ggcattccgctgcacgagctggtgctggtgcaggccggcgtggtgccgaagacctcgagc
ggcaagaaccagcgcacgctggtgcgccagcactacctcgaaggcaagctgccggtgctc
gcgcgcacccagccgggggcgggcgccggcgccgccacggtcaccacggcggtaacgccg
gctgcgccgggcggcagcgtcgacgacctgagcgagcgcgtgatcgtcgcgatgctgggc
gcggcgggcgcggcgcgccccgaagcgcgagccgcctcgccgctcgcgctcggcctcgat
tccctcgccctcgtcgatctgcagacgcgcctggcgcgcgaactcggcatcgccgtggaa
ctggacgacctgatggacgaacggcccgtggccgaactggcgcgcgacctggccgcgcgc
gcgttcgacggcggcggcgcgagcggcggcgaggcgcccgcgcccgccctgccgccggcc
tcagacccgaccgccctgacgccgtaccaggaagcgatctggacggcccagctgtgggac
cccgcgctgccctgcttcaacctggtgctgccgctgcgggtccgggcgccgctctcggcc
ggccacgtgcgcgaggcgctcgcggcgctgacggtcgcacacccgggcctcgcgagccgc
ttcgtgcaggacggcaacggcgacgtgcggcagcagccggcggcggcgacggccgggctg
ctcgacgtgatcaactgcgccgggcagtccgacgacgcgctgcgcgctcgcatcgtcgcc
tccgccagcgcgccaatcgacctggccggcggccccgtgttccgcgccgagctgctgagc
cgcgcgcccgacgatcacctgctggtactgatcgcgcatcacctggtggccgacctcggc
tcgctgcagacggtgctggccgacttcgccgaattccatgcctgcctcgccggggaccgg
ccgctgccggcacgcgccatcgcggccgccggcgtcgccgtgcccgactatcgcacccgg
ctcgccgcgctgctgcacggcccgcgagccgaggccgaccggcaatattgggccgcgcgc
ctcgcgacgccgatcgaaccgctggcgctgccgctcgcgctgcccggcgaggcgccggcg
ggcgtcgtggccggctcgggcatgagcgtcgatgtcgatctcgacgccgcgctggcgggc
gcgctcgacgcgctctgcgccagccggcgcgtgacgcgcaacatggcgctgctggcggca
ttcttcgcgttcctgcaccgctacacggcgcagcgcgacgtggcggtggtgacgccagcg
gccgtgcggcccggcggcgagttcgacgactgggtcggctacggcgtgaacctgctggtg
atccgcgaggcggtggatggcgagctgccgttcgccgcgctgctcgccgcgatgaagcag
accgtggccggcgcgctcgcgcaccgcaccacgccgttcatcgacctggcacggcgcttc
gcgaggcgcgacgacgacgtgcgccacccgttctcgcgggtcctgttcgcctatcacaac
ctgaaccgcctgccgcaggccgccgacctgctggcgggcacggccggccagccgctcgcg
gtcggcgggctcgcgctcgaaagcttcccggtgccgaccccggccgcgcaaaccgacctc
gcgctggtcgcgatccaggccggcgagcggctcgtgctgcgcttcgagtacgacgccacg
ctcgcctcgcgcgccgcaatcgagcgcatggccgcgcatttccgcacgctgctcggcgcg
ctgctcgcgcagccggaccagccggtcgcgcgggccgcgctgctggatccggccgagcgc
gagcggcagctcgtgacgtggaaccgccggccgctggcggccccggccaccggcccggcc
gcgtcggccgcgatgaacctggccgcggactacgccacggtccacgcgatgatcgacgcg
atgtcgcgccgcgtgcccgagcgcctcgccgtgcggaccgacaccgaacagctggactac
gcgcagctgcggcgcgattcggatgcgctggccgccgcgctgcacgcgcgcggcgtgcgc
catggcgacgtggtgggcgtgggcctgccgcgcgacgtgcgcctgccgataatgctgctg
gccatctggaaggccggcgccgcctatctgccgatcgacctcggcgtgccggccgaacgc
gtgcgccagatgctggacgacgcgcaggccgcgctgatcgtcgcgcccgccgcgctgcgc
ggcgcgctcggcgacgacggccgcgcctgggtcacgcccgaggcgctcgcggcggatgcc
gccgccggcgaatctccggccgcgcccgaatctcgcgccggccgcgacagcctcgcctac
gtgctgttcacgtcgggctcgaccgggcgtccgaagggcgtcgagatcgagcatcgcaac
gtgctgtcactgcttgcgtggatcggtgcgcgctactcggccggcgagctggccgccgtg
ttcgcgggcacctcgatcgcattcgacatctcggtgttcgagctgttcggcccgctcgcg
cacggcggctgcgtggtgatcggcgagaacccggccacgccgcccgccaccccggtgtcg
ctgctcaacaccgtgccgtcggccgcggcggcgctgctcgagacgggcgcgctgccggcc
agcgtggtgaccgtcaacctggccggcgagccgctgcgccagtcgctggtggacgcgctg
tacgcgcgcggcacgatcggcaaggtctacgacctctacggcccgaccgaggacaccgtc
tattcgaccgcggtgctgcgcgaacccggcggcttcgacaccatcggcacgccgctgccg
ggcaagcgcgtctacctgctcgacgcgcatggcgagccggtgccggtgggcgtggcgggc
gagctgttcctggccggcgatggccaggcgcgcggctaccgcaaccggcccgacctgacc
gggcgcgcgttcgtcgcggtcccggcgctggccgacctcgagacgcggctctaccgcacc
ggcgacatcggccggctgctgcccgacggccgcatcgtgctgtcgggccggcgcgaccac
caggtgaagatccgcggccaccgcgtcgagctgggcgagatcgaggccgtgctgctgcgt
cagccgggggtgcgcgacgcggtggtggtgcagacgcgccacgccgagcggtccggtgac
gacggcgacagccgggacgcgctgctggtcgcctatctggccgtcggcgacgccgcggac
gaggcggtcggcacgccgccccgcccggtcgtcaccgtcgaggcggtgcgcgagtacgcg
gccgcctcgctgccgagctacatgcgcccgaccggctatgtgctgctcgacgcgctgccg
cgcaacccgagcggcaaggtggaccgcgccgcgctgccgcgcttcgacccggtcgcgcag
gacgacgccgccgcgccggtcagcgacacgcagcgcgcggtgctggcgatctgggaggcg
gtgctcggcttccagggcttcggcatccacgccaacctgttcgagctgggcggccattcg
ctgcaggtgatccagatcatcgcgcgctgccgcgagcgcttcggcgtcgagatctccctg
gccaaggtgctggagcgcaccacggtggccgacctggccgcctacgtcacgttactggcg
gcgcgctccggcgccgccgacgaacccggcggcgtccgggaggaggtgctgttttga

DBGET integrated database retrieval system