KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_4305Help
Entry
KS03_4305         CDS       T03820                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bgu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KS03_4305
Enzymes [BR:bgu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KS03_4305
Transporters [BR:bgu02000]
 Other Transporters
  Pores ion channels [TC:1]
   KS03_4305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
II:complement(1144036..1144710)
Genome map
AA seq 224 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELGIPYELKRYERDPKTLRAPPALRDVHPLGKSPVLTDDG
ETVAESGAIIEYLLERYDTDSRFAPAPGTPERRRFTYWLHYAEGSAMPPLLLKLVTMRIA
QAPMPFFVKPIARKFAATLQSSFVDPQLKLHLGYIEESLRATGWFAGDAFSAADVQMSFP
LEAAASRADAVAQLPAIRAFLERIHARPAYHRALARGGPYDMVR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtccatcacctcaacaattcccgctcgcagcgcgtgctgtggctgctcgaa
gagctcggcatcccctacgagctgaagcgctacgagcgcgatccgaagacgttgcgcgcg
ccgcccgcgctgcgcgacgtgcacccgctcggcaagtcgccggtactgaccgacgacggc
gaaaccgtcgccgagtcgggcgcgatcatcgaatacctgctcgaacgctacgacacggac
tcgcgcttcgcccccgcgcccggtactccggagcggcggcgcttcacctactggctgcac
tacgcggagggctcggcgatgccgccgctgctgctcaagctggtgaccatgcgcatcgcc
caggcgccgatgccgttcttcgtcaagccgatcgcacgcaagttcgccgcgacgctgcag
tcgagcttcgtcgatccgcagctgaagctgcatctcggctatatcgaggagtcgctacgc
gccacgggctggttcgccggcgacgcgttcagcgccgccgacgtgcagatgagctttccg
ctggaggcggccgcctcgcgcgccgatgccgtcgcgcagctgccggcgatccgcgcgttc
ctcgaacggatccatgcgcggcccgcctaccaccgtgcgctggcgcgcggcggtccctac
gacatggtgcgctga

DBGET integrated database retrieval system