KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_4644Help
Entry
KS03_4644         CDS       T03820                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
II:complement(1542904..1548237)
Genome map
AA seq 1777 aa AA seqDB search
MNAFEATMSRFDHLHNFGQCLRHWAAVKPHDTAFRFLTDGVVEAPRLSFAELDRRATAIA
ARLARECPRGEPVLLLYRPGLDFIAAFFGCLYAGCAAVPAYPPSGRATRRNRLAAIIADC
GAGAILTSDELVEAIREEIAQADVPSRAGVIGTDALLAAPGEASDADGAALPASHLAFLQ
YTSGSTGRPKGVRVTHRNLLANERAIREGFGHGPDTVFVGWCPLYHDMGLIGNVLQPVYL
GIPSVLMSPFEFLQQPLKWLRAISTYGATTSGGPNFAYELCATRIAEADKAGLDLSSWRV
AFNGAEPIRASTLDKFAAAFADYGFDAGAMFPCYGMAETTLFVSGAVPGAGALTRRVDAL
ALQAGRCVDAADGQPAAELVSSGRVGGDQQVRIVDPHSLRARGPGEIGEIWVRGGSVADG
YWNREDDTRAQFDARIAGEDSPPFLRTGDLGLLDGGELYVTGRLKELIIIRGRNHYPTDI
EQTVEQSSADFRAGCGAAFAIDGEDGERLVVVQEIQRAVRKSLDAEEAGRRAAAAVAAAH
GIPLHELVLVQAGVVPKTSSGKNQRTLVRQHYLNGELPVLARVRPGAGAEAAAPALPAAP
GDGVDALRERVIAAMLGATGAARPEARATSTLALGLDSLALVDLQTRLAREFGIGVALDE
LMDDRPVAELAHELAARALDGGAIDGATGGEATAPPPPAVDPTALTPYQEAIWTAQLWDP
SSPCFNLVLPLRIRAPLSATQVREALAALTVAHPNLASRFVQDGDGQLRQQPATASAGLL
DVINCAGQSDDALRARIVAATGVPLDLSAGPVFRAELLSRAPDDHVLVLIAHHLVADLGS
LQTVLADFAEFHACLAEGRPLPARATAPDYRARLAALLHEPQAEADRQYWAARLATPIEP
LALPLALPGEAPAGRVAGAGMSVDIDLDAALTGALDTLCAGQRVTRNMALLAAFFAFLHR
YTAQRDLAVVTPAAVRPGGEFDDWVGYGVNLLVIREAVDGELPFTALLAAMKQTVAGALA
HRTTPFIDLARRFARRDADVRHPFSRILFAYHNLNRLPQAADLLAGAAGQPLTVGTLALE
SFPVPTPAAQTDLALVAIQAGERLVLRFEYDATLASRAAVERMAAHFRTLLGALIARPDQ
PVARAALLEAAERERQLVTWNHRPLPAVPAGANVAAEHATVHAMIDAMACRVPERIAVRT
DTEHLDYARLRHDSDALAAALHARGVRHGDVVGVGLPRDVRLPVMLLAIWKAGAAYLPID
LGVPAERVRQMLDDAQATLIVAPAALQSALGDDGRTWVTPEALAADAPAAASPVAPDARA
GRESLAYVLFTSGSTGRPKGVEIEHRNVLSLLAWIGACYTADELAAVFAGTSIAFDISVF
ELFGPLAHGGCVVIGENPATPPATPVSLINTVPSAAAALLETGRLPAGVVTVNLAGEPLR
QSLVDALYARGTIGKVYDLYGPTEDTVYSTAVLREPGGFDTIGTPLPGKRVYLLDAQGEP
VPVGVAGELYLAGDGQARGYRHRPDLTEHAFVSVPALVDLEPRLYRTGDIGRQLADGRIV
LSGRRDHQVKIRGHRVELGEIEAVLLRHPAVRDAVVVQTRHTAPAGDGGDGQDALLVAYL
ASGDVPGEAGGIDAVREFAAASLPSYMRPAGYVLLEALPRNGSGKVDRAALPRFDPFAHD
AAAAPASDAQRAVLAIWEEVLGLHGFSIHADLFELGGHSLQVIRILTRCREHFGVEIPVR
EVLERTTVADLAAYITLLAARSGAADEPGGAREEVLL
NT seq 5334 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcctttgaagccacaatgagtcggttcgatcatctgcacaattttggccaatgc
ctgcgtcactgggcagcggtcaaaccgcacgacaccgcgttccggttcctgaccgacggt
gtcgtcgaggcgccgcgactgagcttcgccgaactcgaccgacgcgccaccgcgatcgcc
gcccgcctcgcgcgcgaatgcccgcgcggcgagcccgtgttgctgctctatcggcccggg
ctcgacttcatcgccgcgtttttcggctgcctctacgcgggctgcgcggcggtgccggct
tatccgccgtcgggccgcgccacgcgtcgcaatcggctcgccgcgatcatcgccgactgc
ggcgccggcgcgatcctgaccagcgacgagctggtcgaggcgatccgcgaggagatcgcg
caggccgacgtgccgtcgcgcgcgggcgtgatcggcaccgacgcgctgctggccgcgccg
ggcgaggcgtccgacgcggacggggccgcgctgcccgccagccatctggcgttcctgcaa
tacacctcgggctccaccggccgccccaagggcgtgcgcgtcacgcaccgcaacctgctc
gccaacgagcgggcgatccgcgagggcttcggccacggtccggacacggtgttcgtcggc
tggtgcccgctttatcacgacatgggcctgatcggcaacgtgctgcagcccgtctatctc
ggcatcccgtcggtgctgatgtcgccgttcgagttcctgcagcagccgctcaagtggctg
cgcgcgatctcgacctacggcgccaccaccagcggcggcccgaacttcgcctacgaactc
tgcgcgacgcgcatcgccgaggccgacaaggccgggctcgatctgtcctcgtggcgcgtc
gcgttcaacggcgccgaaccgatccgcgcctcgacgctcgacaagttcgcggcggcgttc
gccgactacggcttcgacgcgggcgcgatgttcccgtgctacgggatggccgagaccacg
ctgttcgtgtcgggcgccgtgcccggtgccggcgcgctcacgcgccgcgtcgacgcgctc
gcgctgcaggccgggcgctgcgtcgacgcggccgacgggcagcctgccgccgagctggtg
agttcggggcgcgtgggcggcgaccagcaggtgcgcatcgtcgatccgcacagcctgcgc
gcgaggggccccggcgagatcggcgagatctgggtgcgcggcggcagcgtcgccgacggc
tactggaaccgcgaggacgacacgcgcgcccagttcgacgcccgcatcgccggggaggac
tcgccgccgttcctgcgcaccggagatctcggcctgctcgacggcggcgaactctacgtg
acgggccggctcaaggagctgatcatcatccgcgggcgcaaccactacccgaccgacatc
gagcagaccgtcgagcagagcagcgccgacttccgcgccggttgcggcgcggccttcgcg
atcgacggcgaggacggcgagcgcctggtggtcgtgcaggagatccagcgcgccgtgcgc
aaatcgctcgacgccgaggaggccgggcggcgcgccgccgccgcagtggccgccgcgcac
ggcatcccgcttcacgagctggtactggtgcaggccggcgtggtgccgaaaacgtcaagc
ggcaagaaccagcgcacgctggtgcgccagcattacctgaacggcgagctgccggtgctc
gcgcgcgtgcggccgggagcgggcgccgaggccgccgcgccggcgttgccggccgcgccg
ggcgacggcgtcgacgcactgcgcgagcgcgtgatcgccgcgatgctcggcgcgacaggc
gcggcgcgccccgaggcgcgggccacctccacgctcgcgctcggcctcgattccctcgcg
ctcgtcgatctgcagacgcgccttgcgcgcgagttcggcatcggggtggcgctcgacgaa
ctgatggacgaccggcccgtggcggagctcgcgcatgagctggccgcacgtgcgctcgac
ggcggcgcgatcgatggcgcaaccggcggcgaggcgaccgcgcccccgccgcccgccgtc
gaccccaccgccctgacgccctaccaggaggcgatctggacggcgcagctgtgggacccg
tcctcgccctgcttcaacctggtgctgccgctgcgaatccgggcgccgctctcggccacg
caggtgcgggaggcgctcgcggcgctgacagtcgcccatcctaacctcgcgagccgcttc
gtccaggacggcgacggccagctgcggcagcagccggcaacggcgtcggccgggctgctc
gacgtgatcaactgcgcggggcagtccgacgacgcgctgcgcgcgcgcatcgtcgccgcc
accggcgtgccgctcgacctgtccgccggccccgtgttccgcgccgaactgctgagccgc
gcgcccgacgatcacgtactggtgctgatcgcccatcacctggttgccgatctcggctcg
ctgcagacggtgctggccgacttcgccgaattccacgcgtgcctcgccgagggccgtccg
ctgccggcgcgggccaccgcgcccgactatcgcgcccggctcgccgcgctgctgcacgaa
ccgcaggccgaggccgaccggcaatactgggccgcgcgcctcgccaccccgatcgaaccg
ctggcgctgccactggcactgcccggcgaggccccggcgggccgcgtggccggcgcgggt
atgagcgtggacatcgacctcgacgccgcgctgacgggcgcgctcgacacgctctgcgcc
ggccagcgcgtgacgcgcaacatggcgctgctggcggcgttcttcgcgttcctgcatcgc
tacacggcacagcgcgacttggcggtggtcacgccggcggccgtgcggcccggcggcgag
ttcgacgattgggtcggctacggcgtgaacctgctggtgatccgcgaggcggtggacggc
gagctgccgttcaccgcgctgctcgccgcgatgaagcagaccgtggccggcgcgctcgcc
caccgcacgacgccgttcatcgacctggcgcggcgcttcgcgcggcgtgacgccgacgtg
cgccatccgttctcacgcatcctgttcgcctatcacaacctgaaccgcctgccgcaggcc
gccgacctgctggcgggcgcggcgggccagccgctcacggtcggcacgctcgcgctcgaa
agcttcccggtgcccaccccggccgcgcaaaccgacctcgcgctggtcgcgatccaggcc
ggcgagcggctcgtgctgcgtttcgagtacgacgccacgctcgcctcgcgcgccgcggtc
gagcgcatggccgcgcatttccgcacgctgctcggcgcgctgatcgcccgacccgaccaa
ccggtcgcgcgggccgcgctgctggaggcggcggagcgcgagcggcagctcgtgacatgg
aaccaccggccactgccggccgtgccggccggcgcgaacgtggcggcggagcacgccacg
gtccacgcgatgatcgacgcgatggcgtgccgcgtgcccgagcgcatcgccgtgcgcacc
gacaccgagcacctggactatgcgcggctgcggcacgactccgacgcgctggcagccgcg
ctgcacgcgcgcggcgtgcgccacggcgacgtggtgggtgtgggcctgccgcgcgacgtg
cgcctgccggtgatgctgctggcgatctggaaggccggtgccgcctatctgccgatcgac
ctcggcgtgccggccgaacgcgtgcgccagatgctggacgacgcgcaggccacgctgatc
gtcgcgcccgccgcgctgcagagcgcgctcggcgacgacggccgcacctgggtcacgccc
gaggcgctcgcggcggatgcgccggcggccgcctcgccggtcgcgcccgacgctcgcgcc
ggccgcgaaagccttgcctacgtgctgttcacgtccggctcgaccgggcgcccgaagggc
gtggaaatcgagcatcgcaacgtgctgtcgctgctcgcgtggatcggcgcctgctacacg
gccgacgagctggccgccgtgttcgcgggcacctcgatcgcgttcgacatctcggtgttc
gagctgttcggcccgctcgcgcacggcggctgcgtggtgatcggcgagaacccggccaca
ccgcccgccaccccggtgtcgctgatcaacaccgtgccgtcggcggcggcggcactgctg
gagacgggcaggctgccggccggcgtggtgaccgtcaaccttgccggcgaaccgctgcgc
cagtcgctggtggacgcgctgtatgcgcgcggcacgatcggcaaggtctacgacctctac
gggccgaccgaggacaccgtctactcgaccgcggtgctgcgcgagccaggcggcttcgac
accatcggcacgccgctgccgggcaagcgcgtctacctgctcgacgcgcagggcgagccg
gtgccggtgggcgtggcgggcgagctatacctggccggcgacggccaggcgcgcggctac
cgccaccggcccgacctgaccgagcatgcgttcgtctcggtgccggcgctggtcgacctc
gagccacggctctaccgcaccggcgacatcggccgccagttggcagacggccgcatcgtg
ctgtcgggccggcgtgaccaccaggtgaagatccgcggccaccgcgtcgaactcggcgag
atcgaggccgtgctgctgcggcacccggcggtgcgcgatgccgtggtggtgcagacgcgt
cacaccgcgccggccggtgacggcggcgacggccaggacgcgctgctggtcgcctacctg
gccagcggcgacgtgccgggcgaggccggcggcatcgacgcggtgcgcgagttcgcggcc
gcctcgttgccgagctacatgcgtcccgccggctatgtgctgctcgaggcgctgccgcgc
aacgggagcggcaaggtggaccgcgccgcgctaccgcgcttcgacccgttcgcgcatgac
gccgccgccgcgccggccagcgacgcgcagcgcgcggtgctggcgatctgggaggaggtg
ctcggcttacacggcttcagcattcatgccgacctgttcgagctcggtggccattcgctg
caagtgatccggatcctcacgcgctgccgcgagcacttcggcgtcgagattcccgtgcgc
gaggtgctggagcgcaccacggtggccgacctggccgcctacatcacgttactggcggcg
cgctccggcgccgccgacgagcccggcggcgcccgggaggaggtgctgttgtga

DBGET integrated database retrieval system