KEGG   Bacillus glycinifermentans: BGLY_4588Help
Entry
BGLY_4588         CDS       T04537                                 

Definition
(GenBank) catalase
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
bgy  Bacillus glycinifermentans
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgy00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BGLY_4588
  Amino acid metabolism
   00380 Tryptophan metabolism
    BGLY_4588
Enzymes [BR:bgy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BGLY_4588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(4442170..4444245)
Genome map
AA seq 691 aa AA seqDB search
MNKNERRKADKNSKDEQLEYYRTDNRGKKMTTNQGVRISEDEHSLKAGTRGPTLMEDFHF
REKITHFDHERIPERVVHARGFGAHGHFQVYEPMTKYTKAKFLQDPSVKTPVFVRFSTVA
GSRGSGDTVRDVRGFAVKFYTEEGNYDLVGNNIPVFFIQDAIKFPDLVHAFKPEPHNEIP
QASTAHDTFWDFVANNQETAHMIMWAMSDRAIPRSYRMMEGFGVHTFRFVNDKGKARFVK
FHWKPLLGVHSLVWDEAQKIAGKDPDFHRRDLWEAIERGADVEYELGVQMIDEEDEFKFD
FDILDPTKLWPEEMIPVRIIGKMTLNRNQDNVFAETEQAAFHPGNVVPGIDFTNDPLLQG
RLFSYTDTQLIRLGGPNFHEIPINRPVCPFHNNQYDGYHRMTINTGPVAYHKNSLQQNDP
APASEEEGGYIHYQEKVEGRKIRRRSDSFKDHFSQAKLFWNSMSPVEKEHIVSAFRFEVG
KVKSKDVRKQVVEMFNKVDGELAKQIAAGVGVKPPEKDEGSKVMLKSPALSQENTRKSPL
TRTVAILAEDGFSHSEVIRVITALIKAGLVPDVISSHLGAVKGDNGKEIEAGNTLQTADS
VLYDAVYIPGGKDSIERLKKQKAALDFINEAFSHFKAIGAASEGVDLLASAAGTRALSES
GIVTAAGGAPDAFSKKLIEAVGQHRHWERTV
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaatgagcgccgcaaagccgataaaaacagcaaggatgaacagcttgaatac
taccggaccgacaaccgcggcaaaaaaatgacgacaaaccagggcgtgcgcatatctgag
gatgagcattcattaaaggccgggacgcgcggccctacgctgatggaggacttccacttt
agggaaaagatcacccactttgaccatgaacggattccggaacgcgtcgttcacgcgagg
ggattcggagcgcatggccattttcaggtgtacgaaccgatgacaaagtatacaaaagcg
aaatttcttcaggacccttctgtgaaaacgcctgtcttcgtccggttttcgacggttgca
ggctcaagggggtcaggcgataccgtccgcgatgtcaggggatttgccgtgaaattttat
acggaggaaggaaactatgacctcgtcggcaataacatccccgtttttttcatccaggac
gccattaagtttcctgatttggtgcatgcattcaaacctgagccccacaatgaaatcccg
caggcatccacggcgcatgataccttttgggattttgtcgccaacaatcaggagacggcg
cacatgatcatgtgggcgatgtcggacagggcgattccgcgcagctatcggatgatggaa
ggttttggcgtccatacgttcagattcgtgaatgataaaggcaaggcccgttttgtgaag
tttcattggaagccgctgctgggcgtccattctcttgtctgggacgaagcccaaaaaata
gccggcaaagatccggattttcacaggcgcgatctgtgggaggccatcgaaagaggagcc
gatgtagaatacgaacttggcgtacaaatgatcgatgaagaagacgagttcaagtttgat
tttgatatcctcgatccgacgaaactgtggccggaggagatgattccggttcggatcatc
gggaaaatgacgttaaaccgaaatcaggacaacgtctttgcggaaacggaacaggcggcg
tttcacccgggcaacgttgttcccggcatcgattttacgaacgacccgctccttcagggc
cggctgttttcctataccgatacacagctgatccgcttgggcggcccgaactttcacgaa
attccgatcaacaggccggtctgcccgtttcacaacaaccagtatgacggctatcaccgc
atgacgatcaataccgggcctgtcgcatatcataaaaattcgctgcagcagaacgatcct
gcccctgcttctgaagaggaaggcggatatatacattatcaggagaaagtcgaaggtcgg
aaaatccgcaggcgcagcgacagctttaaagatcatttttctcaggcgaagcttttttgg
aacagcatgtctccggtcgaaaaagaacatattgtatcagcgttccgatttgaggtcgga
aaggtcaaaagcaaggacgtccgcaagcaggtcgtcgagatgttcaacaaggtcgacggg
gaactggcgaaacaaattgctgcgggcgtcggcgtaaagccgcctgaaaaagacgaaggc
tcaaaagtgatgctcaaatccccggcactaagccaggagaacacgaggaaatcgccgttg
acaagaacggttgcgattttagccgaagacggcttcagccattccgaagttatccgggtc
atcacagccttgattaaagcggggcttgttcccgatgtcatcagctcgcatttaggcgca
gtcaaaggcgacaacggcaaagaaatcgaagccggaaatacattgcagaccgccgattct
gtgctgtatgacgccgtttatattccaggcggcaaagacagcattgaacggctgaagaaa
caaaaagccgcgttggacttcatcaatgaagcgttcagccattttaaagcgatcggagcc
gcaagcgaaggagttgaccttctggcgtccgcggccggcacccgtgcgctctcagagtcc
ggtatcgtaacggcggccggcggcgcgcctgatgcattcagtaaaaagctgatcgaagcg
gtcggtcagcatcgtcattgggagagaacggtataa

DBGET integrated database retrieval system