KEGG   Bacillus halodurans: BH1563Help
Entry
BH1563            CDS       T00039                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bha  Bacillus halodurans
Brite
Enzymes [BR:bha01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BH1563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF4120
Motif
Other DBs
NCBI-ProteinID: BAB05282
UniProt: Q9KCK8
LinkDB All DBs
Position
1642212..1643093
Genome map
AA seq 293 aa AA seqDB search
MSIEWGQLHAWVNRVEEAWNQNKALLRSESVDTFLFEETLERLKEQLQNDGEPTEIGELA
EHLYEEWARLFSEQTEAGGSNGMRRPVPIGGHRLPPLPYPYEALEPYIDREIMRLHHQKH
HQSYVEGLNKAEKEMERARRTNHFQLIKHWEREAAFNGAGHYLHSIFWEVMSPHGGGEPK
GELRRQIERDFGSFARFKNHFSQAAEKVEGVGWAILVWAPRAHRLEILQAEFHQNLSQQD
AIPLLPLDVWEHAYYLQYKNERKDYIENWWNVVNWDAVEKRYNAAKQLRWTPY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagaatgggggcagctacatgcatgggtaaaccgtgtagaggaggcgtggaat
caaaacaaggcgttgctccgatcagaaagtgtagacacctttttatttgaagaaacgtta
gaacgattgaaggaacaactacaaaatgatggggagccaacggaaattggggagttagcg
gagcacctgtatgaggagtgggcaaggctttttagcgaacagacagaggcaggaggaagt
aacggtatgcggcgacctgtgccgattggcgggcaccggttgccaccattaccgtatccg
tatgaagcattggagccttatattgaccgagaaattatgcggttgcaccatcagaagcat
caccagagctatgtcgaaggactaaataaagccgagaaggaaatggagagagcgagacgg
acgaatcattttcagctgatcaaacattgggaacgggaggccgcttttaatggggcaggt
cattatttgcattcgattttttgggaggtgatgtctcctcacgggggtggggaaccgaaa
ggagaattgcgtcgacaaatcgaacgcgatttcggcagctttgcccggtttaaaaatcat
ttttcccaagcggctgaaaaagtagagggagtcggatgggcgattctcgtttgggcgcct
cgtgctcatcggctggaaattttgcaggcggagtttcatcaaaacttgtcacaacaagat
gctatcccgcttctccctctggatgtgtgggaacatgcgtactatttacaatataaaaat
gagcgaaaagactacattgaaaattggtggaatgtcgtcaactgggatgctgttgaaaaa
cgatacaacgcagctaaacagttacgctggaccccatattaa

DBGET integrated database retrieval system