Bacteroides helcogenes: Bache_0553 Help Entry Bache_0553        CDS       T01393                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bhl  Bacteroides helcogenes Pathway bhl01100   Metabolic pathways bhl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bhl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bache_0553   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bache_0553 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ADV42578 UniProt:  E6SW53 LinkDB All DBs Position 734200..734436 Genome browser AA seq 78 aa AA seqDB search MSEIASRVKAIIVDKLGVEESEVTTEASFTNDLGADSLDTVELIMEFEKEFGISIPDDQA EKIGTVGDAVSYIEEHAK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgaaattgcatcaagagtgaaagcgattatcgtcgacaaattaggcgttgaagaa tcagaagttacaaccgaagcaagcttcactaacgacttaggagctgattctcttgacacg gttgaacttatcatggaattcgaaaaagaattcggtatctctatccctgatgaccaggct gaaaagatcggtactgtaggtgatgctgtatcttacatcgaagaacacgctaagtaa

DBGET integrated database retrieval system