KEGG   Bordetella holmesii ATCC 51541: D560_3748Help
Entry
D560_3748         CDS       T03052                                 

Definition
(GenBank) FAD binding domain protein
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bho00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    D560_3748
Enzymes [BR:bho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     D560_3748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3493032..3494636
Genome map
AA seq 534 aa AA seqDB search
MNSRPSDATPTRAELLARLEPSAPWDVIVIGGGATGLGTAVDAASRGFRTLLLEGADFAK
GTSSKATKLVHGGVRYLAQGNVSLVREALHERGLLARNAPHLAWPLGFVVPAYSMLDQPF
YGVGLKLYDMLAGKLNLAPSRWLSSRETLARASTLAPAVNGQRLRGGVLYYDGQFDDARL
ATALMRTLLDLSGTAINYVKVVGLTRDAQGRIDGVRTHDTIDDTQHTVSGRCVINATGVW
VDAVRRMDDPAAQTMVAPSQGVHLTLPRDFLPGEQAILVPKTDDGRVLFMVPWNGHTIVG
TTDSARTDLPIDPRPMPGEVDFILETAARYLTRKPTRADVTSVWAGLRPLVKATGDASTK
SLSREHTILTAKSGLITVTGGKWTTYRRMAQDVMDTAISKQLLPQAPCRSAQLRLHGAPA
ADARPLAPQGTPDSYYGTDLPALRALPGADRMLVQASGLTEAHVRYAARHELAQSVEDVL
ARRNRALFLDAAAASVAAPEVARILAQELDRDDAWQQRTVADFEAVAATFRLPD
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaactcacgcccttccgacgccacgcccacacgcgctgaacttctcgcccgcctggag
ccctccgctccttgggacgtcattgtcattggtggtggcgccaccggtctgggcacggcc
gtcgatgcggcctcccgcggcttcaggaccctgctgcttgaaggcgcggacttcgccaag
ggaacatccagcaaggccaccaaactcgtgcatgggggagtgcgctatctcgcccaaggt
aacgtcagcctggtacgcgaggcgctgcacgaacgcggactgttggcgcggaacgcgccc
catctggcctggccgctcggattcgtggtcccggcctattcgatgctggaccaacctttt
tatggcgtggggctcaagctctacgatatgttggccggaaaactcaacctggctcccagc
cgctggctatcctcgcgcgaaaccctggcacgggcaagcacgctggcgcccgccgtcaac
ggccaacggctgcgtggaggagtgctgtattacgacggccagttcgacgacgctcggctg
gccacagcgctgatgcgtacgctcctggatctgagtggcaccgcgatcaactacgtcaaa
gtcgtcggcctgacccgtgatgcacaaggccgcatcgacggcgtacggactcatgacacc
atcgatgatacccaacacaccgttagcggccggtgcgtcatcaacgccaccggggtgtgg
gttgatgcggtgcgccgtatggacgaccccgccgcgcaaacgatggttgcccccagtcaa
ggcgtacatttgacgctgccgcgggattttctgcctggcgaacaagccattctggtgccg
aaaaccgatgacggccgggtgcttttcatggttccctggaacggtcataccatcgtcggc
accaccgatagcgcacgtacggatctccctattgatccgcgcccgatgcccggcgaggtg
gacttcatcctcgagaccgccgcccgctacctgactcgcaagcccacgcgtgcggacgtc
accagcgtctgggctggcctgcggccattggtcaaggccaccggcgacgcctccacgaag
tcgctatcgcgtgaacacaccatcctgactgccaaaagcggcctgatcacggtcaccggc
ggcaagtggaccacctatcgccggatggcccaggatgtgatggacactgccatcagcaaa
cagttgctgccgcaagcaccctgccgcagtgcgcagttacgcctgcacggtgcgccggcg
gccgacgccaggccgctggcgccgcaaggcacaccggatagctactacggcaccgatttg
ccggccttgcgtgccctgccaggcgccgaccgcatgctggtccaagccagcgggctgact
gaagcgcatgtacgttatgccgcccgccacgagctggcgcaatcggtcgaagacgtgctg
gcgcgccgcaatcgtgccctcttcctggatgccgcggccgccagcgtggccgcacccgag
gttgcgcgcatcctggctcaggagctcgaccgggacgacgcctggcaacagcgcacggtg
gctgacttcgaggccgttgccgcgacgttccgcttgcccgattga

DBGET integrated database retrieval system