KEGG   Beijerinckia indica: Bind_1894Help
Entry
Bind_1894         CDS       T00688                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
bid  Beijerinckia indica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2156921..2159764)
Genome map
AA seq 947 aa AA seqDB search
MEPRRESPQTASPAKDDPRNLTQDLVVLVRSFVQELHPQRARRLALTLASRLEDDLGIDS
LARTELILRVERAFHVRLPVARVGAAETMADLLRALNEALAGEGGKPADLHPIPALPLVL
AATEAQTLTEVLDWHVARHPDRLHITLLQDDSTILDQLSYGRLAAQARQIARGLIARDIG
PGDRVALMLPTSIEFFCAFFAILYVGAVPVPIYPPMRPSQIEDHLRRQAGILNNAGSRML
ITMPEGLSVAALLRAQLSELESVASVAELMAEAGDMRLPPASTPVSTALIQYTSGSTGDP
KGVILSHANLLANVKAMGAALEANSADVFVSWLPLYHDLGLIGAWFGCLYFGAPLYVMSP
LSFLVRPESWLWAIHRFRATLSAAPNFGFELCTAKIDTAHLTGLDLSSLRAVANGAEPVS
PYTLRRFTEKFAAFGFRPEVMMPVYGLAENAVGLAFSTLGRGPLIDRIDRNALMSRGVAE
PAKANDQNPLELVACGRPLPGHEIRIVDPAGHEIGDRQEGRLEFRGPSATSGYFCNEAKT
RDLIHDGWLDSGDRAYMAEGDVYITGRIKDIIIRAGRHIYPQEIEDAIATIPGIRRGSVA
VFGMTDRVSGTERLVIVAETRETDPAARHEIETRAHELTSAICGTPPDEVVLAPPRTVPK
TSSGKIRRSATRELYQRHQIGVAQGSLWLQVLRLRLAGLGPQFIRVMARGSATLYALWWW
SVICLGYGLAWIAVMLLPRLEWRWAVTRAIGRIALAVLGIQVAVSGLDHIPPGKALLAFN
HSSYLDVIILAAFLPGIPTFVAKKRFLGGMLIIPFLRRLGTFFVERIEMMGDIKDIEMII
AAARQSRMLVMFPEGTFTRRAGLAAFHLGAFKIASEADLPIVPGILQGTRVMLRPGQWFP
RRAPLSLSIEEAIQPTGTDFSSVLQLEQQVRKVILTHCGEPDLGEST
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcgcagagagtcgccgcagaccgcatcacccgccaaggacgatccacgcaat
ctcacgcaagatctcgtggtccttgtgcgcagctttgtgcaggagcttcatccgcagcgg
gcgcgcagactcgcgttgactttggcgagccggcttgaagacgatttaggcatcgacagc
cttgcgcgcacggaactgatcctgagggtcgaacgagcctttcacgtcagactgccggtg
gcacgcgtcggagcggccgaaaccatggccgatctgcttcgggcccttaacgaggcgctt
gcaggagagggaggcaaacctgccgatcttcacccgatcccggcgctgcctttggtgctt
gccgcgacagaagcgcagaccttgacggaagtcctcgactggcatgtcgcgcgccatcca
gaccgtctgcacattactttgctgcaggatgacagcacaatcctggatcagttgagctat
ggccggctcgcggcgcaggcgcgccagatcgccaggggtctcatcgcccgtgacatcggg
ccaggggatcgagtcgcgctgatgctgccgacctccatcgagttcttctgcgccttcttt
gcgattctttatgtcggcgccgtgccagttccgatctatccgcccatgcggccatcgcag
attgaagaccatctgcgccgccaagccggtatattgaacaatgccgggtcgcgtatgctg
atcaccatgccggaagggctgagcgtggcggcattgctgcgggcacaattgagcgaactt
gaatctgtcgcgagcgtcgccgaactgatggcggaagctggtgacatgcgcttgccccct
gcgagcactccagtatcgaccgccttgatccaatatacatccggaagcacgggcgatccc
aaaggggtgatcttgagccatgccaatctgttggccaatgtcaaagccatgggggcggcg
ctcgaggccaattcggccgatgttttcgtgagttggctacctctctaccatgatctgggc
ttgatcggtgcctggttcggctgcctctatttcggggccccgctttatgtgatgtcgccg
ctgagctttctcgtgcgtccggaaagctggctctgggccattcatcgctttcgcgccact
ttgagcgccgcgccgaatttcggcttcgaactctgtacggccaagatcgacacggcccat
ctcaccggccttgatctcagctcgttgcgtgcggttgcgaatggggcggagcctgtatcc
ccctatacattgcgccgcttcaccgagaagtttgcggcctttggcttccggcctgaagtg
atgatgccggtttatgggcttgccgaaaacgccgtcggcctggccttttcaacccttggt
cgaggcccattgatcgatcggatcgaccgtaatgccctgatgagccggggtgtcgccgaa
cccgccaaggcgaacgaccaaaatccgctggagttggtcgcctgcggccgaccgctgccg
ggacatgaaatccggatcgtcgatccggccgggcatgagatcggagacaggcaggagggc
cggctcgagtttcgaggcccgtcagcgacctccggttatttttgtaacgaggccaagacg
agagatctcatccacgacggctggctcgatagcggcgaccgcgcctatatggctgaaggc
gatgtctatattaccggccggatcaaggacatcatcattcgcgcggggcggcatatctat
ccgcaggagatcgaggacgccattgccacaatccctggtatccgcaggggcagtgtcgcg
gtctttggcatgaccgatcgagtatcgggaaccgagcgcctggtgatcgtggccgaaacg
cgtgagacggatcccgccgcgcgccatgaaatagagacgcgcgcccatgagctcacaagc
gccatatgcggcacgccgccagacgaagtcgtcctcgcgccgccgcggactgtgcccaag
acatcaagtggcaagatccgtcgaagcgctacacgagaactgtatcaacgccatcagatt
ggtgtggcgcagggttccttatggttgcaggttttgcgcctacggctggcgggccttgga
ccgcaattcatccgcgtgatggcgcgcgggagtgcgacgctttatgcactctggtggtgg
agtgtcatctgtcttggctatggcttggcgtggattgccgtcatgctcctgccacggctc
gaatggcgctgggccgttacgagggcgatcggccgcattgcgctcgcagtgctgggcatt
caggtcgcggtctctggcctcgaccatattccgcccggcaaggctctgctcgccttcaat
cattcgagctatctggatgtcatcatccttgcggcattcctccccggcattccgaccttt
gtcgcgaagaagcgatttctcgggggaatgctcatcattccgtttttgcgccgactcggc
actttcttcgtcgagcgcatagaaatgatgggggacatcaaagacatcgagatgatcatc
gctgccgcgcggcagagccgcatgctcgtcatgtttccggaaggaaccttcacaagaagg
gccgggcttgcagcttttcatctcggcgccttcaagatcgctagcgaagccgatcttccc
atcgtgccggggatcttgcagggaacgcgcgtcatgctgcggcccgggcaatggttcccg
cgacgggcaccgctcagcttgagcatagaagaagctatacaaccaacggggacggatttc
tcgtcggtgctgcagcttgagcagcaggtgcgcaaagtcatcttgacgcattgcggcgag
ccggaccttggcgaatccacctga

DBGET integrated database retrieval system