KEGG   Beijerinckia indica: Bind_1959Help
Entry
Bind_1959         CDS       T00688                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bid  Beijerinckia indica
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bind_1959
Enzymes [BR:bid01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bind_1959
Transporters [BR:bid02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bind_1959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2234311..2234964)
Genome map
AA seq 217 aa AA seqDB search
MNSATLTISSKNYSSWSLRGWLLTKFAGLPFAEKIISPDDPAMRAELLLLSPSFLVPCLT
HEGIKVWDTLAIGEYLNEIKPEAHLLPEDRMKRTHCRSICGEMHSGFFALRSALPVNLKG
DFPNFKVWERAQADIDRIAVIWRNCLTSYGGPFLMGERSMADAMYAPVVTRFLTYHVTLD
SVCSAYCQQIIAMPEMIEWTEAARLEPEEIVELDAEF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagtgcaacgcttacgatcagcagtaagaactattcgtcttggtcgcttcgtggc
tggttactgacgaaatttgccgggctgccttttgcggaaaagatcatctcgcccgatgat
cccgcgatgcgcgctgagctccttcttttgtccccttcttttctggtgccttgcctaaca
catgaagggatcaaagtgtgggacacgctggcaatcggcgaatatctgaatgaaatcaag
ccggaagcgcatttgctgccggaagacagaatgaaacggacgcactgccgctcgatctgc
ggcgagatgcattccggtttctttgccctgcgttcggctttgccggtaaatttgaaaggc
gattttcctaacttcaaagtctgggaacgggcccaggccgatatcgatcgcattgccgtg
atctggcggaattgtctcaccagctatggcggtccatttcttatgggcgagcgttccatg
gccgacgcaatgtatgcgccggtggtcacgcgattcctcacctatcacgtcacattggat
tcggtctgtagcgcctattgccagcaaatcattgccatgcccgagatgatcgaatggacc
gaggcggcacggctcgaacccgaagaaatcgtcgaacttgacgccgaattctga

DBGET integrated database retrieval system