KEGG   Bacillus infantis: N288_07380Help
Entry
N288_07380        CDS       T02860                                 

Definition
(GenBank) alpha-amlyase
Organism
bif  Bacillus infantis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1333433..1334974
Genome map
AA seq 513 aa AA seqDB search
MKKGVMALILIPFLLFCALPVGAVEKEERKWQDETIYFLMVDRFNNGDFSNDLETNASDP
KAYHGGDFQGIIDQLDYLKDMGFTAIWLTPIFENEAGGYHGYWINDFYKTEENFGSIETF
KKLVKEAHKRDMKIILDFVVNHVGPNHPWVNDPDKQDWFHEQKEITNWENQDELENGWIY
NLPDLAQENPEARQYLLDAAKWWIEETDIDGYRLDTVKHVPVDFWEDFAKEVKSAKEDFY
LLGEVWTDDPAYIAQYEKAGIDGFVDYPLNGHLRTAFEKPGQPFDWLFASWERNQAQYDQ
PYLMGTFMDNHDTVRFTRDAVTNNEHPGPRWRLALTYLYTSPGIPIVYYGSEIALDGGED
PDNRRQMDFRTDQELVEYISNIGTLRQQLPSLTRGTMEPLYNKDGMAVYKRTYEDETTVV
AINNTVKTQTVSLDSGLLEGDKQLKGLLGGDLVRSDEGKYKLIVDREEAEIYALSEKTGL
NIPYLAVMGLVYAAFIVFIILLWRRSKKRKPVS
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggagtcatggctctcatcttaattccgtttcttcttttttgcgccctaccg
gtaggagcagttgaaaaagaagagcgtaaatggcaggatgaaacaatttattttctaatg
gtcgaccgttttaacaacggcgatttcagcaatgacctggaaacaaacgcaagtgacccg
aaagcctatcacggaggggacttccagggtatcattgaccagctagattatctgaaggat
atgggctttacagccatctggctgacgccgattttcgaaaatgaagcaggcggctatcat
ggctactggatcaatgatttttacaaaacggaagaaaacttcggatctatcgagacgttt
aaaaagcttgtaaaagaagcccataagcgtgatatgaaaatcatccttgattttgttgtc
aatcatgtcggacccaatcatccctgggtgaatgatccggacaagcaggactggttccat
gaacaaaaggaaataaccaactgggagaatcaggatgagcttgaaaatggttggatctat
aatcttcctgacctcgcacaggagaatccggaggccaggcaatatctcctggatgcagcc
aaatggtggatagaggaaaccgatattgacggataccgccttgatacggtcaaacatgtg
ccagttgatttctgggaggatttcgcgaaagaagtaaaaagcgccaaggaggatttctat
cttctcggcgaagtatggaccgatgaccctgcttatattgcacagtatgagaaagcaggg
atcgacggatttgtcgattatccgctgaacgggcatctgcgcacggcatttgaaaagccc
gggcagccctttgactggctgtttgccagctgggagaggaatcaggcccaatacgatcaa
ccttatttaatgggaacgttcatggacaatcatgacaccgttcgtttcacgcgcgatgca
gtaaccaacaatgagcatccgggaccgagatggcgtctggccctcacatatttgtatacg
tcaccggggattcccattgtttattatggaagtgaaatagcacttgatggcggggaagat
cccgataaccgccgccaaatggatttccggacagaccaggagcttgtggaatacatctcg
aatatcgggacattaaggcagcagctaccatcccttacgaggggcacaatggagcctttg
tacaataaggatggcatggcagtgtacaagcggacctatgaggatgaaaccactgtcgtg
gccatcaataataccgtcaaaacgcagaccgtctcccttgattccggcctgcttgaaggc
gataagcagctgaaaggccttttgggcggggatcttgtaaggtctgatgagggaaaatat
aagctgatcgttgaccgggaagaagccgaaatctatgcgctgtcagagaagacaggtttg
aatatcccttatctggcagtgatgggactggtctatgcagccttcatcgtctttattatc
cttctttggagaaggtcgaaaaagaggaagcctgtttcctga

DBGET integrated database retrieval system