KEGG   Bifidobacterium indicum: BINDI_0831Help
Entry
BINDI_0831        CDS       T03564                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bii  Bifidobacterium indicum
Brite
KEGG Orthology (KO) [BR:bii00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    BINDI_0831
   04068 FoxO signaling pathway
    BINDI_0831
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    BINDI_0831
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    BINDI_0831
   04212 Longevity regulating pathway - worm
    BINDI_0831
   04213 Longevity regulating pathway - multiple species
    BINDI_0831
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    BINDI_0831
Enzymes [BR:bii01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BINDI_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1104323..1104943
Genome map
AA seq 206 aa AA seqDB search
MPVYTLPELPYDYSALEPYVSGKIMELHHDKHHQAYVNGANQALEQIHDAAESGNVAQSN
LLEKNLAFNLAGHKNHTIFWKNMAPSIGQEPTGELKAAIEDQFGSFEGFQRYFESMCAGI
QGSGWAVLAWDSLGERLVTLQMYDHQGNLPVTIFPLILLDLWEHAYYLDYLNVRADYVKA
WWHIVNWEDASKRFDEVRNLNTNLVK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtatatacacttcctgaactaccttatgactattcggccctcgagccctacgtg
tccggcaagatcatggaactccaccatgacaagcaccatcaggcgtatgtcaacggcgcc
aaccaggcactggaacaaattcacgacgctgccgagtccggcaatgtggcacagtccaac
ctcctggagaagaatctggccttcaacctggccggtcacaagaaccacaccatcttctgg
aagaacatggccccgtccatcggacaggaacccacaggcgaactcaaggcggccatcgag
gaccagttcggttccttcgagggcttccagcggtacttcgagtccatgtgcgctggcatc
cagggttccggctgggccgtcctggcatgggattccctgggtgagcgcctggtcaccctg
cagatgtacgaccaccagggcaacctgcccgtcaccatcttcccgctgattcttctggat
ctctgggagcacgcctactacctggattacctgaatgtcagggcagactatgtcaaggcc
tggtggcacatcgtcaactgggaggatgcctccaagcgcttcgacgaggttcgcaacctg
aacaccaacctggtcaagtaa

DBGET integrated database retrieval system