KEGG   Bombus impatiens (common eastern bumble bee): 100740538Help
Entry
100740538         CDS       T04362                                 

Definition
(RefSeq) histone deacetylase 4
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Brite
Enzymes [BR:bim01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100740538
Chromosome [BR:bim03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100740538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 985 aa AA seqDB search
MQGSVNVGGNRMSSEQARASAVATKEDVGYRSVEIASAFTHLPQKEMARDTPGSPMSRPR
DLVGGVGATTTLTSGGYHAGSGDPASLHGHVLQQKILELQQHHQLQQQILRQQYQAQERQ
LAELHEQQMHQLKLWEQQKQLEEQRREKERLEALRKKDKHDHSAIASTEVKQRLQSFLVN
KKQREAAAAANGAVPGTPGYRTSEPNLLKVRLKQRVERNMAASRNSPLMARRKDRLLSHL
KRKSLLANSSSNPESGPNSPPTVNNSQASPTAAANAAAAIQEETENTGYGGPLTSSSQQG
SLSDLSLFSSPSMPNISLGRPHVPSGSSTTGTKLATVSEAEVRATQVAHARLQKAGHRPL
GSRTQSAPLPLGHPMLQGGIMAPQTHYEEYLAEKQLHDQQQAHNYLKQQIRQTVLTRVGS
RGQANQLDEAPENDESAEVIDLTGGKKDLSEESEISKQQRDREQFLQQQRDLMMRHTLQI
SNESSTAYGGSGTGGGSRSSQPSARPLSRALSSPLVHLTRDAGPQGSQDTTGDLFARASS
HRSTTGLAYDPLMLKHACVCGETVRGHPEHGGRLQSVWARLSETGLLQRCDRIRSRKATL
EEIQTCHSEAHALLFGTNPMNRQKLDVSKLSQLPIKSFVRLPCGGVGVDSDTTWNELNTA
PAARMAVGCVVDLAFKTAMADIKNGFAVVRPPGHHAETNQAMGFCFFNSVAIAARLLQQK
LDIRKILILDWDVHHGNGTQQMFYDDPRVLYMSIHRHDEGNFFPGTGGPTECGAGEGLGY
NVNVAWSGGLNPPMGDAEYLAAFRTIVMPIAKAFDPSIVLVSAGSRFDAAVGHPAPLGGY
KVSPACFGKMTQQLLGLANGKVVLALEGGYDLAAICDSAQECVRALLGDEPTQLREEELT
RIPCQNAVDTLQKTIAVQMSHWPCVKLNAHTVSMSAIEAGQKERDETETVSAMASLSMQQ
PTNLTTTPEHSREVSEEPMEQDDAK
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgcagggttcggtgaatgttggaggaaacagaatgtccagcgaacaagcgcgagcaagc
gccgtcgcgaccaaagaagacgtgggttacaggagcgttgagatcgcgtccgcgtttacg
catctaccgcagaaagagatggcccgggatacgccaggctcgccaatgtccagaccgaga
gacctggtcggcggagttggtgctacgaccaccttgacatcgggcggctatcacgctggt
tccggcgatccagcgagcctgcatggtcacgtgctgcagcagaagatactcgagctacag
cagcatcatcaacttcagcaacaaatactgcggcaacagtaccaagcccaggagcgacag
ttggccgagttacacgagcaacagatgcaccagctaaagctctgggagcagcaaaaacag
ctggaagagcagaggagagaaaaagagagactcgaagcactgaggaagaaggataaacac
gaccacagtgcgatcgcttcgacggaggtgaagcaacgacttcagagcttcctcgtgaac
aagaagcaaagggaggccgcggccgctgcgaacggggccgtacctggtacacccggatac
agaacctcggagccgaacctgctgaaggtgcgactaaagcaacgcgtggagaggaacatg
gccgcgtcgagaaattcacccctgatggcacgccggaaggatcgcctgctgtcgcacctc
aagcggaaatcactgctagcaaattctagcagtaatccggaatctgggcctaattcacca
ccgaccgtaaacaattctcaagcgagtcccaccgcggcagccaacgcagcggcagccatc
caagaagagacggaaaacaccggctacggaggtccattgaccagcagcagtcagcaaggt
agcctgtcggatctgtcgttgttcagttcaccgtccatgcccaacatctcgctggggcga
cctcacgttccatccggttccagtacgaccggtacgaaattggccaccgtctcggaggca
gaggtacgcgcgacgcaagtagcgcatgcgaggctgcaaaaggctggtcaccggccttta
ggtagtaggactcagtcggcgcctctgccgttgggccatccgatgctgcaaggtggcatc
atggcgccgcagacccattacgaggagtacctggccgagaagcaactgcacgatcagcag
caggcgcacaactacctcaaacagcagattcgtcaaacggtgttgacgcgtgtcggatct
cggggacaggcgaatcagctggacgaagcaccggagaacgacgagtccgccgaggtgata
gatctcaccggaggcaagaaagatttgtcggaggagagcgagatctcgaaacagcaacgg
gatcgcgaacagtttcttcagcagcagagagatctgatgatgagacacaccttgcaaata
tccaacgagtcgtcgacggcctacggcggaagcggtaccggtggcggcagcaggagcagt
cagccgagtgccagaccgctgtccagagcgctgtccagcccgttggttcacttgacgcgc
gacgcaggtcctcagggaagccaagacaccaccggtgatctgttcgcgcgcgcttcttcc
catcgatccactaccggtttggcctacgatccgttgatgttgaagcacgcctgtgtctgc
ggcgaaacggttcgtggtcatcccgagcacggaggcagattgcagagcgtctgggcacgg
ctgtcggagacaggactgctacagcgttgcgatcgaatacgttcgcgcaaagccaccctc
gaggagattcaaacgtgtcacagcgaagctcacgctcttctctttggaacgaatccgatg
aaccgacaaaagctggacgtatcgaagctctctcaacttccgatcaagagtttcgtgcgg
ctgccctgcggcggagtaggcgtcgattccgacaccacgtggaacgaactgaataccgcg
ccggccgcccggatggctgtcggttgtgtcgtcgatctggcctttaaaaccgccatggct
gacattaagaacggtttcgccgtcgtaagaccgcccggacatcacgccgaaaccaaccag
gccatgggtttctgcttcttcaattcggtcgcgatcgctgctcgattgcttcagcagaag
ctcgatatcaggaaaatcttgatcctggattgggatgtccatcatgggaacggcacgcag
caaatgttctacgacgacccacgggtgctgtacatgtcgatacacaggcacgacgaaggt
aacttctttccaggaaccggtggaccgaccgagtgcggggctggcgagggtctgggctac
aacgtgaacgtagcctggtccggtgggctgaatcctccgatgggtgacgcggaatatcta
gccgcgtttcgtacgatcgtcatgccgatcgccaaggcgttcgatcccagcatcgtcctc
gtctcggcaggatcgagattcgacgccgccgttggccatcccgcgcccctcggaggctac
aaagttagccccgcttgcttcggcaagatgacgcaacagttgctcggactggcgaacggt
aaggttgttctcgctctcgaaggtggttacgatttggccgcgatttgcgactccgcccaa
gaatgcgttcgggctctgctcggggacgaacctactcaacttcgggaagaggaattgacg
aggataccttgtcaaaacgcggtcgacacgctgcaaaagacgatcgccgtgcagatgtct
cattggccttgcgtcaagctgaacgcgcacacggtgtcgatgagcgcgatcgaagctgga
cagaaagagcgcgacgaaaccgagacggtctccgcgatggcctctctgtcgatgcagcag
cctaccaatttaacgactaccccagaacattcccgagaagtttccgaggagccaatggaa
caggatgacgccaaatga

DBGET integrated database retrieval system