KEGG   Bombus impatiens (common eastern bumble bee): 100740601Help
Entry
100740601         CDS       T04362                                 

Definition
(RefSeq) elongation factor Tu, mitochondrial-like
Organism
bim  Bombus impatiens (common eastern bumble bee)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITSVLAKKFGGQARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALQALN
GVAEWEDKIVELAEALDTYIPEPERDIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
DEVEIVGIKDTAKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKREEIERGQVLAKPGSIK
PHTDFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDEGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccccacgttaacgtcggtacaatcggccac
gttgaccatggtaaaacaactttaactgctgcgatcaccagcgtacttgctaaaaaattc
ggtggtcaagcacgagcattcgatcaaatcgataatgcaccagaagaaaaagcacgtggt
atcaccatcaatacatcacacgttgagtacgatacgccaactcgtcactacgcacacgta
gactgcccgggccatgctgactatgttaaaaacatgatcacaggtgcggcacaaatggac
ggagctatcttagtagtagcagcaacagatggtcctatgccacaaacacgtgagcacatc
cttttaggtcgtcaagtaggtgttccttacatcatcgtattcttaaacaaatgtgatatg
gttgatgacgaagagttattagaattagttgaaatggaagtacgtgaacttctatctcaa
tatgatttcccaggtgatgatacaccagtgattcgtggttcagcattacaagcgttaaac
ggtgttgctgagtgggaagacaaaattgttgaattagcggaagcgttagacacttatatc
ccagagccagagcgtgacattgataaaccattcttattaccaatcgaagatgtattctca
atctcaggacgtggtacagtagtaacaggtcgtgtagagcgtggtatcatcaaagttggt
gatgaagttgaaatcgtaggtatcaaagatacagcgaaaacaacttgtactggtgttgag
atgttccgtaaactgttagacgaaggtcgtgcaggtgagaacgtaggtgtgttattacgt
ggtactaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccaggttcaattaaa
ccacatactgatttcgaatcagaagtgtatatcttaagcaaagatgaaggtggtcgtcat
actccattcttcaaaggttaccgtccacagttctacttccgtacaactgacgtaacagga
actatcgagttaccagaaggcgtagagatggtaatgccaggtgataacattaagatgaca
gtatcattaattcacccaatcgcgatggatgaaggtttacgtttcgctatccgtgaaggt
ggtcgtactgttggtgctggtgttgttgctaaaattattaaataa

DBGET integrated database retrieval system