KEGG   Bombus impatiens (common eastern bumble bee): 100741044Help
Entry
100741044         CDS       T04362                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Brite
Enzymes [BR:bim01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100741044
Peptidases [BR:bim01002]
 Metallo Peptidases
  Family M2
   100741044
Exosome [BR:bim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100741044
CD molecules [BR:bim04090]
 Proteins
  100741044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 657 aa AA seqDB search
MTKMRILRKLIGIMIICSLMQRSCSKYLEGMNVNLGDAVQFLREYDSEASAMCTRVMTAQ
WNFATNVTEENRRRMIEEQTLKLKFDRISWRKAVSFAWSRIGDPFAKRELKMIAIRGRNS
LTDDKFNELHSLILEMKEIYVRTRVCPYRTIGANCDLNLDHDVNKIMAKSKDYDELLYYW
HAWHEATGPQLKNKYMRYIQLANQAARLNGFEDAGDQMRELFEDEYFRQNTADVMSAIMH
LYKNLFTYVRTKLFERYGDKIRRDGPIPAHILGNMWAQNWEDLFDLVQPFPASKKLDVTL
EMMIRRFTPLRMFQIAEEFFTSLGMKPMPPEFWRFSMFEKPIDREVKCTPSAWDFCNRMN
YSIKQCTRVTMEDLLSTHHEIARLQYFLQYSDQPLLFRNEAIPGFFEAVSDAIELSVFTP
QHLSKLELHDNSTDDYGSDINFLMLMALRKVAYMPFAYIVDEWRWRVFNEGVTDMTNKWW
ELRLQYQGIVPPVPRSERDFDPGSKYHIPADALYAKYFVGVVLQFQLFESLCEIAGHTGD
LHTCDFYRSREAGRLLSDVLSIGSSRSWKDVVRQMTRGRTNRMDANAILRYFEPLNKWLK
RQNEMEPVVGWITNRDDTDLLEFISALFFHWYQNGARKITSQLFLPLALISTRISIC
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaatgaggattctgaggaaattgattggtataatgattatttgttctcttatg
cagagaagctgtagcaaatatttagagggtatgaacgtgaatttaggggatgctgtacaa
tttcttcgagaatatgatagtgaagcttctgcaatgtgcacgagagtgatgacagcgcaa
tggaattttgcaacaaatgtcactgaagaaaatcgtcgaagaatgatagaagaacagact
ttgaagttgaaatttgaccgaatttcgtggcgcaaggctgtcagtttcgcttggagtcga
ataggagatcccttcgctaaaagggaactcaagatgatcgctatcaggggacgaaattct
ttgacagatgacaaatttaatgagttgcacagtctgattctcgaaatgaaggaaatatat
gtgcgaacaagggtgtgtccttatagaactataggagcaaattgtgacctgaatttagac
catgatgtgaataaaataatggcaaaatctaaggactatgatgaattattatattattgg
catgcttggcatgaagctactggacctcaacttaaaaataaatatatgagatacattcaa
ctagcaaatcaagctgctagactaaatggatttgaggatgcaggtgatcaaatgagagaa
ttgttcgaagatgaatactttcgacagaacacagcagacgtaatgtcagcgatcatgcat
ttgtacaaaaatctctttacttatgtaagaacgaaattattcgaaagatacggcgataaa
ataagaagggatggaccaattccggcgcatattttaggaaatatgtgggcacaaaattgg
gaagatcttttcgacctagtacagccatttccagcaagtaaaaaattagacgtcactttg
gaaatgatgattcgaagattcacacctttaaggatgttccaaatagcagaggaattcttt
acttctcttggaatgaagccaatgccacctgaattctggagattttcgatgtttgagaaa
cctatcgacagggaagtcaagtgtactcccagtgcttgggatttttgcaataggatgaat
tacagcattaagcagtgtacgagggttacgatggaagatttactatcaacacaccatgag
atcgctcgattgcaatacttcttacaatatagcgatcaaccattattatttcgaaacgag
gcaattccaggatttttcgaagcagtcagtgacgccattgaactttccgtgttcacccct
caacatttaagtaaactcgaattacatgacaattctacggatgattatggaagcgatatc
aatttcttgatgctaatggcccttcgtaaagttgcctacatgccatttgcgtacatagtt
gatgagtggaggtggcgtgtattcaacgagggtgttacggatatgacaaataaatggtgg
gaattaagattgcagtatcaaggaatcgtgcctccagtaccacgatccgaaagagatttt
gatcctggatcgaagtatcatatcccagctgacgctctttatgccaaatattttgttggt
gttgtcttgcaatttcaattgttcgaatctttatgtgaaatagcaggccacactggtgat
ttacatacttgtgatttttatagatcaagagaagctgggagattattatccgatgtgcta
tcaattggttcgtccagatcttggaaagatgtggtacgacaaatgacaagaggtaggaca
aacaggatggatgctaatgctatattaagatatttcgagcccctaaataaatggctaaaa
cgacaaaatgaaatggaacctgttgttggttggatcacaaatcgcgatgacacagacctt
cttgaatttatttcagcgttattttttcactggtaccaaaatggcgctcgaaaaatcact
tcacagttattcctcccactggctttgattagtacgcgaatctcaatatgttaa

DBGET integrated database retrieval system