KEGG   Bombus impatiens (common eastern bumble bee): 100742115Help
Entry
100742115         CDS       T04362                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  
succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bim00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100742115
  Energy metabolism
   00190 Oxidative phosphorylation
    100742115
Enzymes [BR:bim01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100742115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 661 aa AA seqDB search
MSGLLKLSSLLARNPPTTTLNKFGLLVITNRKLHYTPDGKAAKISDNVSKHYPLVDHTYD
AVVVGAGGAGLRAAYGLVAEGFKTAVITKLFPTRSHTVAAQGGINAALGNMEEDNWQWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTSDGKIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGQSLSYECNYFVEYFALDLLMEDGECRGVIALSLEDGT
LHRFHAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMISRANLPNQDLEFVQFHPTGIYGA
GCLITEGSRGEGGYLVNSEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGVGPEKDH
IYLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVIPTVHYNMGGIPTNYRGQVLT
RKNDEDTVVPGLYACGESACASVHGANRLGANSLLDLVVFGRACAKTIAAENKPGEAIGP
LKPNAGEESVANLDWVRNANGSISTAELRLSMQKTMQTHAAVFRTAETLQEGCQKMSALY
NKLSDLKVSDKSMIWNSDLVESLELQNLMINAMQTIVAAENRKESRGAHAREDFRDRIDE
YDYSKPIGNQEPKSLDQHWRKHTLTKINPRTGEVSIEFRPVIDNTLDKQECATVPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtcttttgaagctatcgtctttactggcgagaaatcctcccacaacgacgttg
aacaaatttggattactggtcattacaaatcgcaaacttcattataccccagatggcaag
gctgcaaaaatctcagacaatgtttctaagcattatccattagtagatcatacttatgat
gctgttgttgtgggtgctggtggagcaggattgcgtgcagcttatggcttggtcgctgaa
ggattcaagacagcagtcattactaaactatttcctacaaggtcacatactgttgctgct
caaggaggtatcaatgctgctttgggtaatatggaggaagataactggcagtggcacatg
tatgacacagttaagggatctgactggttgggtgatcaggatgctattcattatatgaca
cgtgaagcaccaaaggcagtcattgaattggagaattgtggcatgcctttcagtcgaact
tcagatggcaaaatatatcaacgtgcttttggtggacaatccctgaaatttgggaaaggt
ggtcaagctcacagatgttgctgcgtagcagacagaacaggtcattctctacttcataca
ttatatggtcaatcattaagctatgagtgcaactattttgtcgaatacttcgccctggat
ttactaatggaggatggagagtgcagaggtgtgattgctctttctttggaggacggtaca
ctccatcgttttcatgctaaaaacacagtactagcaactggaggctatggtcgtgcatat
ttttcttgcacatctgctcatacatgcactggtgatggcactgcaatgatatctagagcc
aatttgccaaatcaggacttggaattcgtgcaattccatcctactggaatatatggagct
ggttgcctcattacagaaggcagtcgcggtgaaggaggctatctagttaatagtgaaggt
gaaaggtttatggaacgttatgctccagtcgcgaaagatttagcctctagggacgttgta
tctaggtctatgactatagaaatccgggaaggcagaggcgttggtccagagaaagatcat
atctatttgcaactccatcatttacctcctgaacagttagcagccaggctacctggtatt
tcagaaacagcaatgatatttgctggagttgatgtaacaagagaacctattcctgttata
cctacggtacactataatatgggaggaatacctacaaactacagaggtcaggttctaaca
agaaaaaatgacgaggatacagttgtgcctggactatatgcctgtggagaatcagcttgc
gcatctgttcatggtgccaatcgtcttggtgcaaattcattattagatctagttgtgttt
ggtcgtgcttgtgctaaaacaatcgcagcggaaaataagccaggagaagccattggtcct
ctgaaacctaatgctggagaagaaagtgtagcaaatttggattgggttagaaatgcaaat
ggcagtatttctacggcagaattgagattaagcatgcagaaaactatgcaaacccatgca
gccgtgttcagaacagctgaaacattacaagaaggctgtcagaagatgtctgctttatac
aacaagttgagcgatttgaaggtgtcggacaaatctatgatctggaattctgatcttgta
gagtctcttgaattacaaaacttaatgatcaatgctatgcaaacaatagtagctgcggaa
aataggaaagaaagtcgcggggctcatgcacgtgaagattttagagatagaattgatgaa
tacgattatagtaaaccgatagggaaccaggagcccaaatcactggatcaacattggcga
aaacacacacttacaaaaatcaacccacgaacaggcgaagtatctattgagtttagacca
gtcatagataatactctagataaacaagaatgtgcgacggttccacctgcaattcgttcc
tactag

DBGET integrated database retrieval system