KEGG   Bombus impatiens (common eastern bumble bee): 100743950Help
Entry
100743950         CDS       T04362                                 

Definition
(RefSeq) annulin
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Brite
Enzymes [BR:bim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100743950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 756 aa AA seqDB search
MDSVFRSFSRDEFAFPSPRRMFYRFYDRYRSFNDRRSNPFPFRFYWEDFGVPVLTIADVD
PCIAENGVNHRTSRYDLMTRQDDKSRLVVRRGQEFYLHLTLSRDYEPSIDGMSIIFTVDG
VERPLYGHGTLVATAVLYPGEPSEGPWHATIDAIQHNFIRLKIVAAPDAIIGKWRIDIDT
KNKNLDGAVSYTVKQPFYLIFNPWCREDAVYMEEEDQRQEYVMAEDGLIWRGSYNRLRPT
VWKYSQFERDILDCALHLMIQVGKVRIHGRNDPVVISRILSAAVNSPDDNGAVMGNWSDD
FGGGTPPTKWLGSQKILQQYYKTKKPVKYGQCWVFSGVLATVCRTLGLPCRVVTNYASAH
DTQSSLTVDYFVDAEGKVMEEMNSDSIWNFHVWNEVWMTRLDLSPEYSGWQAIDATPQEL
SEDAYRCGPASVAAVKKGEVLRPYDNAFLFAEVNADKVFWRYNGPTQPLKLIRKDVYGIG
QFISTKAIGRWAREDITHTYKYPEKSEEERAAMLKALRQSQSLFSRYYLNEEFNDVMFNF
ELRDDIVIGQPFSVVLLIKNRSNYNEYEVSVILRVETVLYTGRVGDPVKRLNIDRLVRPG
VLEEVRMDVSWEEYGPRLLNQCAFNISCLATIKDTNFEYFAQDDFRVRKPDIKITLENEP
EVGKTLNATAKFQNPLPIPLKKCRFLIEGPGMDEQLKLKLSDQVEVDAYAECSFSMVPKF
EGRATIAAKFYSKELEDVDGFVNFMVKSMKAVTNGE
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggattcagtctttcgttcgttttcgagggacgagtttgcattcccgagtcctcgaagg
atgttttatagattttacgatcgttaccggtctttcaatgatcgccgttccaatcccttt
ccattcagattttactgggaagattttggagttccagtgttgacgatcgcagacgtggat
ccgtgtatcgcggagaatggagtcaatcacagaacatccagatacgacttgatgactaga
caggacgacaaatctaggctggtcgttagacgggggcaagaattttacttacacttgact
ttgtccagagattacgagccaagtatcgatggtatgtcgataattttcacggttgacgga
gtcgagaggccgctatacgggcacggaaccctcgttgcgacggctgttctttatccggga
gaaccgtccgagggtccctggcatgccaccatcgacgctattcaacacaattttattcga
ttgaagatcgttgcagctcccgacgcgataataggcaagtggaggatagacatcgacacc
aagaacaagaatttagacggagccgttagttacacggtgaaacaaccgttttatctaatt
ttcaatccctggtgcagagaggacgcggtgtacatggaggaggaagatcagcgacaggag
tacgtgatggcggaggatggtttgatatggcgtggaagctacaatcgtctgagaccaacg
gtttggaaatattcgcagttcgagcgggacatattagattgcgcgctgcatctgatgatt
caagttgggaaagttcgaatacacggcagaaacgatcctgtcgttatatctcgcattctg
tcggcagctgtaaattcgccggacgacaatggcgcggtaatgggtaactggtccgacgat
tttggaggtggtacaccaccgaccaaatggttgggttcgcaaaagatcctgcaacaatac
tataagacgaagaaaccggtcaagtatggtcaatgctgggtattctcgggagtgttggcc
accgtttgccgtaccctgggactaccttgtcgcgtggtaaccaattatgcgagcgcgcac
gacactcagagcagcttgaccgtcgactatttcgtcgacgccgaggggaaagttatggag
gagatgaacagcgattcgatatggaatttccacgtgtggaacgaggtatggatgactcga
ttggacttgtcgccggaatattctggttggcaagcgatcgatgcgactcctcaagaattg
agcgaggacgcgtaccgttgcggaccggcttccgtcgccgctgtgaagaaaggcgaggtt
ctccgaccttatgacaatgccttcctcttcgccgaggtcaacgcggataaagtgttttgg
cgttacaacggaccgactcaacctttaaagttgattcgaaaggacgtgtacggcatcggg
caatttattagcacgaaagcgatcggtagatgggcgagggaagatatcactcatacctac
aagtatccagaaaagtcggaagaagaacgggctgccatgttgaaggcgttgcgtcaaagt
cagtcgttgtttagtcgttattacctgaacgaggagttcaacgacgtcatgtttaacttc
gagttacgcgacgatatcgtgatcggacaacctttcagtgtcgtgttgctgattaaaaat
agaagcaattacaacgagtatgaggtctcggtgattttaagagtggagacggttctgtac
accggacgggtcggcgacccagtgaagagattaaatatcgatcgactggtgagacctgga
gtcctcgaggaagtgcgtatggatgtatcctgggaggaatacggacctcgactattgaat
cagtgcgcattcaatatttcctgcctggccaccatcaaggacaccaatttcgagtacttt
gcgcaagacgactttcgcgtgaggaaacccgacattaaaatcacgttggagaacgagccg
gaagttggcaagacgctaaacgcgacagcgaaatttcaaaatccgctgcccatcccactg
aagaagtgcagattcttgatcgagggacctggaatggacgagcagctgaaattgaaactg
tcggaccaggtagaggtggacgcgtacgcggaatgttcgttctctatggtaccgaaattc
gaaggccgcgccacgatcgctgcgaaattttactcgaaagagctcgaggacgttgacggt
ttcgtcaattttatggtaaaatcgatgaaagctgttacaaacggcgagtaa

DBGET integrated database retrieval system