KEGG   Bombus impatiens (common eastern bumble bee): 100744462Help
Entry
100744462         CDS       T04362                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bim00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100744462
   00650 Butanoate metabolism
    100744462
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100744462
   00280 Valine, leucine and isoleucine degradation
    100744462
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100744462
Enzymes [BR:bim01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     100744462
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     100744462
Amino acid related enzymes [BR:bim01007]
 Aminotransferase (transaminase)
  Class III
   100744462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 498 aa AA seqDB search
MLANKCQTALFTQKFSRQLFKGYAISWKRCLTVSVEEPKKPIVTTEIPGPRSRSLLQELT
SMQQASSVQFFADYEKSVGNYITDVDGNTLLDVYMQISSMPLGYNHPAMLKALADPVNQK
IIANRPALGVFPGKDWPDKLRKILLHKEIAPPGLSHITTMMCGSCSNENAFKTIFIWYAE
KQRGDAPFTREEMESCMMNQTPGTPRFSILSFKGAFHGRTLGSLSTTHSKYIHKIDIPGF
DWPTASFPVYKYPLDENIRENQQEDNRCLAEVEELFEKYKTEKKIPVAGVIVEPIQAEGG
DNHASPEFFQELQRITKKHDAALLIDEVQTGGGPTGKMWCHEHFNLESPPDVVTFSKKMQ
LGGYYHVKSLKPKQSYRIFNTWMGDPSKMILLEAILETIRKENLLHRVTTVGDYMLKQLM
SLQNEFSTMINSIRGRGTFIAFNCSSPELRDTIIKKLLSKGIQTGGCGTATIRLRPALTF
TEHHANIFLDTLRSILKQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctaacaagtgtcaaactgcgctctttactcaaaaattttcacggcagttgttc
aaagggtatgcaatatcttggaagagatgcttgaccgtatccgtagaggaaccaaaaaaa
cctatagtaacaacagaaataccaggacctcgatctcgtagtttattgcaggaactcact
tcgatgcaacaagcctcttccgtacaattcttcgcagactacgaaaaatcagtaggtaac
tatataacggacgtcgatgggaatactctgcttgatgtttatatgcaaatttcgtcgatg
cctctgggctacaatcatccagctatgttaaaagctctcgctgatccggttaatcagaaa
attatagcaaataggcctgcgttaggtgtttttcctggaaaggattggccagataaactg
aggaaaattttgctacataaagagattgccccaccgggattgtctcacatcacaaccatg
atgtgtggctcttgttcgaatgaaaatgcatttaaaacaatttttatttggtatgctgaa
aaacaaaggggagacgctccgttcacgagagaggaaatggaaagttgtatgatgaatcaa
acacctggtactccgcgattttcgatactttcgttcaaaggtgcatttcatggacgaaca
ttgggatctctttcaacaacgcacagcaaatacattcataaaatagatattccagggttt
gattggcccaccgcgtcatttcctgtatataaatatcccttggatgaaaatattcgagaa
aatcagcaagaagataatcgatgtctagccgaagtagaggaattattcgaaaagtacaaa
actgagaagaaaattccagttgctggtgtgatagttgaaccaattcaggcggaaggaggt
gataatcacgcatctcctgaattttttcaagaattacagcgtataacaaaaaaacacgat
gcggcattattaatcgatgaagtacaaactgggggtgggccaacaggaaaaatgtggtgt
cacgaacatttcaatttagaatctcctccagatgtggtgacctttagcaagaaaatgcaa
ttgggcggctattaccatgtcaaatctttaaaacctaaacaatcctaccgtatattcaac
acctggatgggagatcccagcaaaatgatattactcgaagcaatattagagacgataagg
aaggaaaatcttttgcatagggttacgactgttggcgattatatgctaaaacaattaatg
agtttgcaaaatgaattttccacgatgattaattcgatacgtggacgtggaacgttcatt
gcatttaactgctcttcgcctgaattacgagatacgataattaagaaacttttaagcaaa
ggtattcaaaccggtggctgtggtactgcgacgataagattaagacctgccttgacattt
acggaacatcatgcgaatattttcttagatactctgcgatctatattaaaacaataa

DBGET integrated database retrieval system