KEGG   Bombus impatiens (common eastern bumble bee): 100745740Help
Entry
100745740         CDS       T04362                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit gamma-1
Organism
bim  Bombus impatiens (common eastern bumble bee)
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma Methyltrn_RNA_4
Motif
Other DBs
NCBI-GeneID: 100745740
NCBI-ProteinID: XP_012241114
LinkDB All DBs
Position
Unknown
AA seq 70 aa AA seqDB search
MDMVTTNLQQQRQITEQLRREAALKRITVSKAVEDIMKYITEHEQEDYLLVGFSSQKSNP
FRERSYCTIF
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atggatatggtgaccaccaatttacaacaacaacggcaaattacggagcagctacgacgt
gaagctgctttaaaacgaattacagttagcaaagctgttgaagatatcatgaaatacatt
acagaacacgagcaagaagattatcttttggttggtttttcatcacagaaatcgaatccc
tttcgtgaaagaagttactgtaccattttttaa

DBGET integrated database retrieval system