KEGG   Bos indicus (zebu cattle): 109553548Help
Entry
109553548         CDS       T04792                                 

Gene name
ASH1L
Definition
(RefSeq) histone-lysine N-methyltransferase ASH1L
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
biu  Bos indicus (zebu cattle)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:biu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109553548 (ASH1L)
Enzymes [BR:biu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109553548 (ASH1L)
Chromosome [BR:biu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109553548 (ASH1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
3
AA seq 2965 aa AA seqDB search
MDPRNTAMLGLGSDSEGFSRKSPSAINTGTLVSKREVELENNTKEEEDLRKWNRERNTEA
GKDNGLTDAQQQFSVKETNFTEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTIKHPR
KALKSGKMTDEKNEHCPSRRDPSKLYKKSGDVAAIECQSEETIHLHSQGENSPLSKKLSP
VHSEMTDYINATSSTLVGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKL
ATGTTAGLVSKDLIRKAGVGSVAGIIHKDLIKKPTISTAVGLVTKDPGKKPVFNATVGLV
NKDSVKKLGTGTTTVFINKDLGKKPGAITTVGLLSKDTGKKLGIGIVPGLVNKEPGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVANSTXGLVNKDIGKXLVSCPMTGLVNKD
AINLKAEALLPTQEPLKASCSTNIISHESQDLSESLKDGATSKTFEKNVTRQSKESILEK
FSVRKEIINLEKEMFNEGTCIQQDSFSSSERGSYETSKHEKQPPVYCTSPDFQMGVASDA
STAKSPFSAVGESNLPSPSPTVSVNPLSRSPPETSSQMTPNPLLLSPTTELMEEISESVG
KNQFTSESTHLNIGHRSMGHSMNIECKGIDKELNDSKTTHIDISRINSSLGKKPSLTSES
SIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTTLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVTCSSLSNSNSEPAKFMKNIGPSSFVDHDFLKRRLP
KLSKSTXPSLALLTDSEKPSHKSFATHKLSSSMCVSSDLLSDIYKPKRGRPKSKEMPQLE
GPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQSLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPTVCSMS
DLEMEPDKKITKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHN
TVSSLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPYLHLHS
RQGSMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPISESHSDETIPSD
SGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
SYDKMKRQKRKRKKKYPQLRNRQDPDFIADLEELISRLSEIRITHRSHHFIPRDLLPTIF
RINFNSFYTHPSFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYP
SYGMPYSPSPLTAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHAGHLLLNPTKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSSEQPQV
SMDAGSSRSVLESLKRYRFGKDTVGERYKHKEKHRCHMSCPHLSPSKSLINREEQWVHRE
PSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSDPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRPHRKEPLPSSERAVQTLTGSQPASDKSSQRPSESTNC
SPARKRSSSESTSSTVNGVPSRSPRLVSSGDDSVDSLLQRMVQHEDQEPLEKNIDAVIAS
ASVPPSSSPVHSLSKERTLGKPDSLLVPAVPSDSCSSSISLLSEKLPSSHSPHHIKRSVV
EAMQRQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPLQA
VVSMQAFQAAQFVGSELNEGEEGTALHLGPDTVTDVIEAVVQSVNLNPDHKKGLKRKSWL
LEEQTKKKQKPFPEEEEEEENAKSFTEAAVEIPSPPETPAKPPEPESTLQPVLSLIPREK
KAPRPPKKKYQKAGLYSDVYKTTDPKSRLIQLKKEKLEYTPGEHEYGLFPAPIHVGKYLR
QKRIDFQLPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYEATTCNCKKPDDD
TKKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEP
LKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHS
CDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGII
GGKSQRMNGLTSNKSSQPXTSHKKSGRSKEKRKSKHKLKKRRGHLSEEPSENINTPTRLT
PQLQMKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKHTSDNIHSASLYTRWNGICRDD
GNIKSDVFMTQFSALQTARSVRTRRLAAAEENIEVARAARLAQIFKEICDGIISYKDSSR
QSLAAPLLNLPPKKKNADYYEKISDPLDLSTIEKQILIGYYKTVEAFDADMLKVFRNAEK
YYGRKSPVGRDVCRLRKAYYNARHEASAQIDEIVGETASEADSSETSVSEKENGHEKDDD
VIRCICGLYKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDREVPMIPRPH
YTQPGCVYFICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSYRLLSHINRDKLDIFRI
EKLWKNEKEERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYEIIPLEAVVGTCCVLDL
YTYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFDHFPKKLTPKRDF
SPHYVPDNYKRNGGRSSWKSERSKPPLKDLGQEDDALPLIEEVLASQEQAANEMPSLEEP
EREGATAENSESEKKKEESSQEPQVACTPEERRHNQRERLNQILLNLLEKIPGKNAIDVT
YLLEEGSGRKLRRRTLFIPENSFRK
NT seq 8898 nt NT seq  +upstreamnt  +downstreamnt
atggaccctagaaatactgctatgttaggattgggttctgattccgaaggattttcaaga
aagagtccctctgccatcaatacgggcacactggtcagcaagagagaagtagagctagag
aacaacacaaaggaagaagaagaccttcgcaagtggaatcgggaaagaaacactgaagca
gggaaagataatggtttgactgatgcacagcaacagttttcagtgaaagaaacaaacttt
acagaaggaaatttaaaattgaaaattggccttcaggctaagagaactaaaaaacctcca
aagaacttggagaactatgtatgtcgacctgccataaagacaactatcaagcacccaagg
aaagcacttaaaagtgggaagatgacagatgaaaagaatgaacactgcccttcaagacgg
gatccttcaaagttgtacaagaaatcaggtgatgttgcagccattgaatgccagtctgaa
gaaaccatccatcttcattcacagggagaaaacagtcctttgtctaagaagctttctcca
gtacactcagaaatgacagattacattaatgcaacatcatctactcttgttggtagccgg
gatcctgatttaaaggacagggcattacttaatggaggaacaagcgtaacggaaaagttg
gcacagctcattgcaacttgtcctccctccaagtcttccaagacaaaaccgaagaagtta
gcaactggcactactgcaggattggttagcaaggatttgatcaggaaagcaggtgttggc
tctgtagctggaataatacataaagacttaataaaaaaaccaactatcagcacagcggtt
gggttggtaactaaagatcctgggaaaaagccagtgtttaatgcaacagtaggattggtc
aataaggactctgtaaaaaaactaggaactggcactacaacggtattcattaataaagac
ttaggcaaaaagccaggggctatcactacagtaggactgctgagcaaagatacaggaaag
aagctaggaattggtattgttccaggtttagtgaataaggaacctgggaagaaactagga
cttggcactgtggttggactagttaataaagacttgggaaagaaattgggttcaactgtt
ggcctggtagccaaggactgtgcaaagaagattgtagcaaattcaacartgggattagtt
aataaggacattggaaagraactagtgagttgtcctatgacaggattggtcaataaagat
gccataaaccttaaagcggaagctctgctccccactcaggaaccacttaaggcttcttgt
agtacaaacatcattagtcatgaaagtcaggacctttctgaatccctgaaagacggtgcc
accagcaaaacttttgagaagaatgtcacacggcagagtaaagaaagcatattggaaaag
ttctcagttcgaaaggaaatcattaatttggagaaagaaatgtttaatgaaggaacatgt
attcagcaagacagtttctcatccagtgaaagggggtcttatgaaacctcaaagcatgaa
aagcaacctcctgtatattgcacttctccagactttcaaatgggagttgcttctgatgca
tctacagcaaaatccccttttagtgcagtaggagaaagcaatctcccttccccatcacct
actgtatctgttaatcctttatccagaagtccccctgaaacttcttcacagatgactcct
aatccattacttttaagtcctaccacagaactaatggaagaaatttctgaatctgttgga
aagaatcaatttacttctgaaagtacacatttgaacattggtcataggtctatgggtcat
agcatgaatattgaatgtaaagggattgataaagagctaaatgattctaaaactacacat
atagatatttcaagaataaactcttctctgggaaaaaagccaagtttgacttctgaatcc
agtattcatacaattaccccttcagttgttaacttcactagtttatttagtaacaagccc
tttctgaaacttggtgcagtatctgcatctgacaaacactgccaagttgctgaaagccta
agcactactttgcagtccaaacccttaaaaaaaaggaaaggaagaaaacctcggtggact
aaagtggtggcaagaagcacatgccggtctccaaaagggctagaattagaaagatcagag
ctttttaaaaatgttacgtgtagttcactatcaaatagtaattccgagccagcaaagttc
atgaaaaacattggaccatcttcatttgtagatcatgatttccttaaacgccgattgcca
aagttgagcaaatctacarctccttctcttgctctcttaactgatagtgaaaaaccatct
cataagtcttttgctactcacaaactgtcctccagtatgtgtgtctctagtgaccttttg
tctgatatttataagcccaaaagaggaagacctaagtctaaggagatgcctcaactggag
ggcccacctaagaggactttaaaaattcctgcttccaaagtcttttctttgcagtctaag
gaagaacaagaacccccaattttacagccggaaattgagattccttctttcaaacaaagt
ctgtctgtgtctccttttccaaaaaagagaggcagacccaagaggcaaatgaggtcacca
gtcaagatgaagccacctgtactatcggtggctccatttgttgccactgaaagtccaagc
aagcttgaatctgaaagtgataaccatagaagtagcagtgatttctttgagagtgaggat
caacttcaagatccagatgatctagatgacagtcataggccaactgtctgtagtatgagt
gaccttgagatggaaccagataaaaaaattaccaagagaaacaatggacaattaatgaaa
acaattatccgcaaaataaataaaatgaagactttaaagagaaagaaactgttgaatcaa
attctttcaagctctgtagaatcaagtaataaagggaaagtgcaatccaaactccataat
acagtgtcaagtcttgccgctacatttggctctaaattgggccaacagataaatgtcagc
aagaaaggaaccatttacataggaaagaggagaggtcgaaaaccaaaaactgtcttaaat
ggcattctttctggtagccctaccagccttgctgttcttgaacaaacagctcagcaggca
gctggatcggcattaggacagattcttccccctttgctgccttcatctgctagtagttct
gagattcttccatcacctatttgctctcagtcttctgggactagtggaggtcagagccct
gtaagtagtgatgcaggctttgttgaacccagttcagtgccatatttgcatttacactcc
agacagggcagtatgattcagactcttgcaatgaagaaggcctcaaaggggaggaggcgg
ttatctcctcctactttgttgccaaattctccttcacacttgagtgaactcacatctctg
aaagaagctactccttcgcctattagtgaatctcatagtgatgagaccattcccagtgat
agtggaattggaacagataataacagcacatcagaccgggcagagaaattttgtgggcaa
aaaaagaggaggcattcttttgagcatgtttctctgattccccctgaaacctctacagtc
ctaagcagtcttaaagaaaaacataaacataaatgtaagcgcaggaatcatgattacctc
agctatgacaagatgaaaaggcaaaaacgaaaacggaaaaagaaatacccccaactccga
aatagacaggatccagacttcattgcagatctggaggaattaataagtcgcctaagtgaa
attcgaatcactcatcgaagtcatcattttattccccgagacctccttccaactattttt
cggatcaactttaatagtttctatacacatccttctttccccctagaccctttgcactac
attcgaaaacctgacttaaaaaagaagagagggagaccccctaagatgagggaggcaatg
gctgaaatgccttttatgcacagccttagttttcctctctctagtactggattctatcct
tcttacggcatgccttactctccctcaccccttacagctgctcccataggattaggttac
tatggaaggtatccccccactctttatccacctcctccatcgccttctttcaccactcca
cttccacctccttcctatatgcatgctggccatttacttctcaatcccaccaaataccat
aagaaaaagcataagttacttcgacaggaggcctttcttacaaccagcaggactcccctc
ctttccatgagtacttaccctagcgtccctcctgagatggcctatggttggatggttgag
cacaaacacaggcaccggcacaaacacagagaacatcgttcttctgagcaaccgcaggtt
tccatggacgctggctcttccagatccgtcctagaatctttgaagcgctatcgatttgga
aaggacactgttggagagcgatataaacataaggaaaagcaccggtgtcatatgtcctgc
cctcatctctctccttcaaaaagtttaataaacagagaagaacagtgggtgcaccgagag
ccttcagaatctagtccattggccttgggattgcagacacctttacagattgactgttca
gaaagttctccgagtttatcccttggaggattcactcccaactctgatccagccagcagt
gatgaacatacaaaccttttcacaagtgcaatagggagctgcagagtttcaaaccctaac
tccagtggccggaagaaattaactgacagccctggactgttttctgcacaggacacttca
ctaaatcggcctcacagaaaggaaccactgccttccagcgaaagggcagtacagacctta
acaggttcccagccagcctcagataagtcttcccagcgaccatcagagagcacaaactgt
agccctgcacgaaagaggtcttcatctgagagtacttcttcaacagtgaatggagttccc
tctcgaagtccaagattggtttcttctggggatgactctgtggatagtctgctgcagcga
atggtacaacatgaggaccaagagcccttggagaaaaatattgatgctgtgattgcatct
gcttctgtgccaccttcctccagtccagtccacagcctcagcaaggagcgaaccctagga
aaaccagacagccttctagtgcctgcagtccccagtgactcttgcagtagtagcatctca
ctcctttctgaaaagttgccaagcagccattccccccatcatattaaaagaagtgtagta
gaagctatgcagcgccaagctcggaaaatgtgcaattatgacaaaatcttggccaccaag
aaaaacctggaccatgtcaataaaattttaaaagccaaaaaacttcaaagacaggccagg
acagggaataactttgttaaacgcagaccaggtcgacctcggaaatgtcctctccaggct
gtggtatcaatgcaagcattccaagctgcccaatttgttggttcagaattaaatgaaggc
gaagaaggaacagcactgcaccttggtcctgatacagttacagatgttattgaagctgtt
gttcagagtgtaaacctgaatccagaccataaaaagggattgaagaggaaaagttggcta
ttggaagaacagaccaagaaaaagcagaagccattcccagaggaagaagaagaagaggag
aatgctaaaagctttactgaagcagcagttgagattcccagtcctcctgaaaccccagcc
aaacctcccgaacctgaaagtaccttgcagcctgtgctttctctcatcccaagagaaaag
aaggccccacgtcccccaaagaagaagtatcagaaagcagggctgtattctgatgtttac
aaaactacagacccaaagagccgattgatccaattaaagaaagagaagctggaatacact
ccaggagaacatgaatatggattattcccagcccccattcatgttggaaaatatctaagg
caaaagagaattgattttcagcttccctatgacattctttggcagtggaaacataatcag
ctgtacaagaaaccagatgtcccactatataaaaaaattcgttcaaatgtctacgttgat
gtcaaacccctttctggttatgaggctaccacttgtaactgtaagaagccagatgatgac
accaaaaagggctgtgtggatgactgcctcaatagaatgatctttgctgagtgttccccc
aacacttgcccctgtggtgagcagtgctgtaaccagaggatacagcggcatgagtgggtg
caatgtctagaacgatttcgagctgaagaaaaaggttggggaatcagaaccaaagaaccc
ctaaaagctgggcagttcatcattgaatacctaggagaggttgtcagcgagcaggagttc
aggaacaggatgattgagcagtatcataatcatagtgaccactattgtctgaacttggat
agtgggatggtgattgacagttaccgtatgggaaatgaggcccgattcatcaatcacagc
tgtgacccaaattgtgaaatgcagaaatggtctgttaatggagtgtaccggattggacta
tatgctcttaaagatatgccagctggtactgaactcacttatgattacaactttcattcc
ttcaacgttgaaaaacagcaactgtgtaagtgcggctttgagaaatgtcgaggaatcatt
gggggcaagagtcaacgcatgaatggactcaccagcaacaaaagtagccaaccartgacc
tcacataaaaagtctggacggtcaaaagagaaaaggaagtctaagcacaagctgaagaaa
aggagaggccacctctctgaggaacccagtgaaaacatcaacactccaacaaggttgacc
cctcaattacaaatgaagccaatgtccaatcgggagagaaactttgtattaaagcatcat
gtgttcctggtccgaaactgggagaagattcggcagaaacaggaggaagtaaagcacacc
agtgataatattcattcagcatcattatatacccgttggaatggcatctgccgagatgat
gggaacatcaagtctgatgtcttcatgacccagttctctgccctgcagactgctcgatct
gttcgaacaagacggttagcagcagcagaggaaaacattgaagtagctcgggcagctcgc
ctagcccagatcttcaaagagatctgtgatggcataatctcttataaagattcttcccga
caatcactagcagcaccacttttgaacctacccccaaagaaaaagaatgctgattattat
gagaagatctctgatcccctagatctttccaccatagagaagcagatcctcattggttat
tataagacagtggaggcttttgatgctgacatgctcaaggtctttcggaatgcagagaag
tactacgggcgtaaatccccagttggaagagatgtttgccgcctacgaaaggcctattac
aatgctcggcatgaggcatcagcccaaattgatgagattgtgggagagacagcaagtgag
gcagacagcagtgagacctcagtctcagagaaggagaatgggcatgagaaagacgatgat
gttatccgctgtatctgtggcctctacaaggatgaaggcctcatgatccagtgtgacaag
tgcatggtgtggcagcactgtgactgtatgggagtgaactcagatgtggagcactacctt
tgtgagcagtgtgacccgaggcctgtggacagagaggtacccatgatccctcggccccac
tacacgcaacctggttgtgtctacttcatctgtttgctccgagatgacctgctgcttcgt
caaggtgactgtgtatatctgatgagggatagtcggcgcacccctgatggccaccctgtc
cgtcagtcctatcgactgttatctcacattaatcgagataaacttgacatattccgcatt
gagaagctttggaaaaatgaaaaagaggaacggtttgcctttggtcaccattattttcgt
ccccatgaaacccaccactctccatcccgtcggttttatcacaatgaactctttcgagtg
ccactttatgagatcattcccttggaggctgtagtggggacctgctgtgtactggatctt
tatacatactgtaaagggagacccaaaggagtgaaggagcaagatgtgtacatctgtgat
tatcggctagacaagtcagcacacctgttttacaagatccaccggaaccgctatcctgtc
tgcaccaaaccctatgcctttgatcacttccccaagaagctcactccaaaaagagatttc
tcacctcattatgtcccagacaactacaagaggaacggagggcgatcatcctggaagtct
gagcgctcaaagccacccctgaaagacctgggccaggaggatgatgctctgcccttgatt
gaagaggttctagccagtcaggagcaagcagccaatgagatgcccagcctggaggagcca
gaacgggagggagccactgctgaaaacagtgagagtgaaaaaaaaaaagaggaaagtagt
caagaaccccaagtagcctgtacccctgaggagcgacggcataatcaacgggaacgactc
aaccagatcttgctcaatctccttgaaaaaatccctgggaaaaatgccatcgatgtgacc
tacttgctggaagaaggatcaggcagaaaacttcgaaggcgtactttgtttatcccagaa
aacagctttcggaagtga

DBGET integrated database retrieval system