KEGG   Bos indicus (zebu cattle): 109555305Help
Entry
109555305         CDS       T04792                                 

Gene name
SETDB1
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETDB1
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
biu  Bos indicus (zebu cattle)
Pathway
Lysine degradation
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:biu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109555305 (SETDB1)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109555305 (SETDB1)
Enzymes [BR:biu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109555305 (SETDB1)
Chromosome [BR:biu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109555305 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109555305 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
3
AA seq 1288 aa AA seqDB search
MSSLPGCLGLAAATAAVESEEIAELQQSVVEELGISMEELRQFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGNRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSNSQDL
HKGTLSQMPGELSKDGDLVVNMRILGKKRTKTWHKGTLIAIQTVGSGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTSTGTQFKPMEPPQPTAPPAPPAPPGPALSPQAGDSESLEG
QLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENAPGGKPGINQTYRSPLGSTTSAPA
PPAPPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRSEQYRGKNPLL
VPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFCLD
PYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINT
GPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECLPTGVYEC
NKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDF
ADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPRSP
XRQLRXHFCKDEDFSTSSVWRSYATRRQTXGPKENGLSEMSSKTLAPQTRAPTYPVPPSI
PVGGCNPXSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSEGGEGRTGGSRGEAEK
ASTSGLGFKDEGDIKQAKKEDPDDRNRMSIVTESSRNYGYNPSPVKPEGLRRPPSKTSMH
QSRRLMASAQPNPDDILTLSSSTESEGESGTSRKPTAGQTSAAAVDSDDIQTISSGSEGD
DFEDKKNMSGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVEKGESAPIRKNTRQFYDG
EESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTW
DYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctccctgggtgccttggtttggcagctgcaacagcagcagtggagtctgaa
gaaattgcagagctgcaacagtccgtggttgaggagctgggcatctcaatggaggagctt
cgacagttcattgatgaagaactggaaaagatggactgtgtacagcagcgcaagaagcaa
ctagcagagttggagacttgggtaatacaaaaggaatctgaggtggcccatgttgaccaa
ctctttgatgatgcatccagggcagtgactaactgtgagtctttggtgaaggacttttat
tccaaactgggactacagtaccgggacagcagctctgaagatgaagcttcccggcctaca
gaaataattgagattcctgatgaagacgatgatgtccttagtattgattcaggtgatgct
gggaacagaactccaaaagaccagaagctccgtgaagctatggctgccttaagaaaatcg
gctcaagatgtccagaagttcatggatgctgtcaacaagaagagtaattcccaggatcta
cacaaaggaaccttgagtcagatgcctggagaattgagcaaagatggtgacttggtcgtc
aacatgcgcatccttggcaaaaaaagaactaagacgtggcacaaaggcacccttattgcc
atccagacagttgggtcagggaagaagtacaaggtgaaatttgacaacaaaggaaagagt
cttctgtcaggaaaccacattgcctacgattaccaccctcctgctgacaagttgtatgtg
ggcagtcgagtagtggccaaatacaaagatgggaatcaggtctggctctatgctggcatt
gtagctgagacaccaaacgtcaaaaacaagctcaggtttctcattttctttgatgatggc
tatgcttcctatgtgacacagtctgaactgtatcccatttgccggccactgaaaaagact
tgggaggacatagaagacatctcctgccgagacttcatagaagagtatatcaccgcttac
cccaaccgccccatggtgttgctcaagagtggccagctgatcaagaccgagtgggaaggc
acgtggtggaagtcccgagtcgaggaggtggacggcagcctagtcaggatcctctttctg
gatgacaaaagatgtgaatggatctatcgaggctctacgcgactggagcccatgttcagc
atgaagacatcatccgcctctgcactagagaagaagcaagggggacagctcagaacacgt
ccaaatatgggtgctgtgagaagcaaaggtcctgtggtccagtacactcaggatctaaca
agtactggaacccagttcaagcctatggaacccccacagccgacagccccacctgcccca
cctgccccacctggtccagctctgtccccccaggcaggtgacagtgaaagcttggaaggc
cagcttgcccaatctcggaagcaggtagccaaaaaaagcacatctttccggccaggatct
gtgggctctggtcattcctcccctacatcccctgcactcagtgaaaatgcccctggtggg
aaacctgggatcaatcagacatataggtcacctttaggctccacaacctctgccccagca
cccccagctcccccagcacccccagccttccatggcatgctggagcgggcccctgcagag
ccctcctaccgtgcccccatggagaagcttttctacttacctcatgtctgcagctatact
tgtctgtctcgagtcagacctatgagaagtgagcagtatcggggcaagaaccctctgtta
gtcccactactctatgactttcggcgaatgacagcccggcgccgagtaaaccgcaagatg
ggctttcatgttatctataagacaccctgtggcctctgccttcggacaatgcaggagatt
gagcgttacctttttgagactggctgtgacttcctcttcctggagatgttctgtttggat
ccatatgttcttgtggaccgmaagtttcagccctataagcctttttactatattttggac
atcacctatgggaaggaagacgttcctctatcctgcgttaacgagattgacacgactccc
ccacctcaggtggcctacagcaaggaacggatcccgggcaagggtgttttcattaacaca
ggccctgartttcttgtcggctgtgactgcaaagatgggtgccgggacaagtccaagtgt
gcctgccatcagctaactatccaggctacagcctgcaccccaggaggccaaatcaacccc
aactctggctaccaatacaagagactagaagaatgtctgcccacaggagtttatgagtgt
aacaaacgctgcaaatgtgaccctaacatgtgcacaaaccggttggtacagcatggcctg
caggttcgtctgcagctcttcaagacccagaacaagggctggggtatccgttgcttggat
gacattgccaaaggctcctttgtctgtatttatgcagggaagatcctgacagatgacttt
gctgacaaggagggcctagaaatgggtgatgagtactttgccaatctggaccatattgag
agcgtggagaacttcaaggaggggtatgagagtgatgccccctgctcctctgacagcagt
ggtgtagacttgaaggaccaggaagacggcaacagtggtacagaggacccgaggagtcca
tgacgacagctcagatgacacttctgtaaggacgaggacttcagcaccagctcggtgtgg
cgcagctatgctacccgacggcagaccnncgggccaaaggaraatggattgtctgagatg
tcttccaagactctcgccccccagactagggcccccacatatcctgtccctccatcaatc
cctgtaggtggctgcaatccancttcctctgaagagacacctaagaacaaagtggcctcg
tggttgagctgcaacagtgtcagtgaaggtggctttgctgactctgatagccgttcatcc
ttcaagactagtgaaggtggggaaggccgcactgggggaagcagaggggaagctgagaag
gcttccacctcagggcttggcttcaaggatgagggagacatcaagcaggccaagaaagag
gaccctgatgaccgaaacaggatgtcaatagttactgaaagctctcgaaattatggttac
aatccttctcctgtgaagcctgaaggacttcgccgcccaccaagtaaaactagtatgcat
cagagccgacgactcatggcctctgctcagccaaaccctgatgatatcctgaccctgtcc
agcagcacagaaagtgagggggaaagtgggaccagccggaagcccactgctggccagact
tcagccgcagccgtggacagtgatgatatccagaccatctcctctggctctgaaggggat
gactttgaggacaagaagaacatgtctggtccaatgaagcgccaagtggcagtaaaatcc
acccggggttttgctttgaaatcaacccatggcattgccattaaatcaaccaacatggca
tctgtggaaaagggggagagtgcacccattcgtaagaacacacgccagttctatgatggg
gaggagtcttgctacatcatcgatgccaagcttgaaggcaacctgggccgctacctcaat
cacagttgcagccctaacctgtttgtccagaatgtcttcgtggatactcatgatctccgc
ttcccgtgggtggccttcttcgccagcaagagaatccgggctggcaccgagcttacctgg
gactacaactatgaggtgggcagcgtggaaggcaaggagttgctttgctgctgcggggcc
atcgaatgccgagggcgtcttctttag

DBGET integrated database retrieval system