KEGG   Bos indicus (zebu cattle): 109556936Help
Entry
109556936         CDS       T04792                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04371  Apelin signaling pathway
biu05034  Alcoholism
biu05165  Human papillomavirus infection
biu05169  Epstein-Barr virus infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    109556936 (HDAC4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    109556936 (HDAC4)
  Substance dependence
   05034 Alcoholism
    109556936 (HDAC4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    109556936 (HDAC4)
   05165 Human papillomavirus infection
    109556936 (HDAC4)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109556936 (HDAC4)
Chromosome [BR:biu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     109556936 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 109556936
NCBI-ProteinID: XP_019813859
LinkDB All DBs
Position
3
AA seq 1000 aa AA seqDB search
MKPTQSSTRPPSQPSIHPPSQQSIHPSTLPVIHSSTQSAVHPSSQKTQHSSLDQSSPPQS
GASASYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTA
LKKRPLDVTDSACSSAPGSAPSSPNNSSGNVSTENGIAPAVPSIPAETSLAHRLVAREGS
VGPLPLYTSPSLPNITLGLPATGPSTGAAGQQEAERLALPALQQRISLFPGTHLAPYLGA
APLERDAGAAPGSLLQHVVLLEQPPTQTPLVTDRYLAGLGALPLHAQPLVGAERVAPSVH
KLRQHRPLGRTQSAPLPQSTQALQHLVIQQQHQQFLEKHKQHFQQPQLHLNKMIPKPSEP
ARQPESHPEETEEELREHQALLEEPFLDRLPGQKETHTLAGVQVKQEPIESDDEETEPPR
EAEPGQRPPTEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSP
ASATFPMSVQEPPAKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGL
RGKCECIRGRKATLEELQTVHSETHALLYGTNPLNRQKLDSSLTSVFVRLPCGGVGVDSD
TIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVA
IAAKLLQQRLSVSKTLVVDWDVHHGNGTQQAFYSDPRVLYISLHRYDDGNFFPGSGAPDE
VGTGAGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGH
PTPLGGYNLSAKCFGYLTKQLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNELDP
LPEKVLQQRPNANAVRSMEKVIEIHSQYWRSLQRLASTAGYSLVEAQKCENEEAETVTAM
ASLSVAVKAPEKSHVAGPXLGAAGLNFEACGXGEPGSSLPEALGALAGGQQVSTLYPFAG
NPVMPRTSCPPALRAFQLRLRAPEPHQQAAVPRPPPAAWD
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccacccagtcatccactcgtccacccagtcagccgtccatccatcctcccagt
cagcagtccatccatccctccacactcccagtcatccactcgtccacccagtcagccgtc
catccatcctcccagaagacgcagcacagctcgctggaccagagctccccgccccagagc
ggggcgtcagcctcctacaaccacccagtcctgggcatgtatgacgccaaagacgacttc
cccctcagaaagacagcttctgaacccaacctgaaattacgctccaggctaaagcagaaa
gtggctgagagacggagcagccccctgctacgcaggaaagatgggccagtggtcacggct
ctgaaaaagcgtcccttggatgtcacagactcggcgtgcagcagtgccccaggctccgcg
cccagctcrcccaacaacagctccgggaacgtgagcacggagaacgggatcgcgcccgcc
gtccccagcatcccrgccgagaccagcctggcacacagactcgtggcacgagagggctcg
gtgggtccgctgcccctctacacgtcaccatccctgcccaacatcacactggggctgccc
gccaccggcccctccacgggggcggccggccagcaggaggccgagagactggccctcccc
gccctgcagcagcgcatctccctcttccctggtacccacctcgccccctacctgggcgca
gcgcctctggagcgggacgcgggggcagccccgggctccctcttgcagcatgtggtcctc
ctggagcagccgcccacgcagacgcccctcgtcacagaccgctaccttgcaggcctgggc
gcgctgcccctgcacgcgcagcccctggtaggggcggagcgagtggcsccctcggtgcac
aagctgcggcagcaccgcccgctgggccgcacgcagtcggcgccgctgccccagagcacg
caggcgctgcagcacctggtcatccagcagcagcaccagcagttcctggagaagcacaag
cagcacttccagcagccgcagctgcacctcaacaagatgatccccaaacccagcgagccr
gcccggcagccygagagccaccccgaggagacagaggaggagctgcgggagcaccaggcg
ctcctggaggagcccttcctggaccggctcccagggcagaaggagacccacacactggcc
ggggtgcaggtgaagcaggagcccatcgagagtgatgacgaggagacggagcccccgmgg
gaggcggagcccggccagcggccgcccacagagcaggagctgctcttcagacagcaagcc
ctcctcctggagcagcagcggatccaccagctgaggaactaccaggcgtccatggaggct
gctggcatccccgtgtcctttggcgggcaccggcccctgtcccgggcacagtcctccccc
gcatccgccaccttccccatgtccgtgcaggagcccccagccaagccaaggttcaccaca
ggcctcgtgtacgacactctgatgctgaaacaccagtgcacttgcgggaacaccaacagc
cacccagagcaygccgggcgcatccagagcatctggtcgcggctgcaggagaccggcctg
cgaggcaaatgtgagtgcatccgcggacgtaaggccacgctggaggagctgcagacagtg
cactcggagacacacgccctgctgtacggcacgaaccccctcaacaggcagaaactggac
agctcactaacgtccgtgttcgtcaggctgccctgcggtggtgtcggggtggacagtgac
accatatggaacgaggtgcactcgtcgggggccgcccgcctggccgtgggctgtgtggta
gagctggtcttcaaggtggccacgggggagctgaagaatggctttgctgtggtccgccct
ccaggacaccacgcagaggagagcacgcccatggggttctgctacttcaactccgtagcc
atcgctgccaagcttctccagcaaaggctgagcgtgagcaagaccctcgtggtggactgg
gatgtgcaccatgggaacggaacccagcaggccttctacagcgacccccgcgtgctctac
atctccctgcaccgctacgacgacggcaacttcttcccgggcagcggcgcgcctgacgag
gtgggcacgggcgccggcgtgggctttaacgtcaacatggctttcaccggcggcctggac
ccccccatgggagacgcagagtacctcgcagccttcaggaccgtggtcatgccgatcgcc
agcgagttcgccccggacgtggtgctggtgtcctcgggcttcgatgccgtggagggccac
cccacgcccctcggaggctacaacctctccgccaagtgtttcgggtacctgacaaagcag
ctgatgggcctggccggcggccgggttgtcctggcgctggaggggggccacgatctcaca
gccatctgcgacgcctcggaagcctgcgtctctgccctgctggggaatgagctcgatcct
ctcccagaaaaggtcttacagcagagacccaatgccaacgcygtgcggtcgatggagaag
gtcattgaaatccacagccagtactggcgctccctgcagaggcttgcctccaccgctggc
tactccctagtcgaggcccagaagtgtgagaacgaggaagccgagactgttactgccatg
gcctcgctgtctgtggcggtgaaggcccctgagaagagccacgtggcagggccctgkctg
ggagcagcaggcctgaactttgaagcctgtggcsgcggggagcctggatcctcgctgcct
gaggccttgggggcgctggccgggggtcagcaagtgagcactttatacccctttgcagga
aaccccgtgatgccgcggacctcgtgtccccctgccctccgggccttccagctgcgcctc
cgggcgccygagccccaccagcaggcagccgtcccccggccgcccccggccgcctgggac
tag

DBGET integrated database retrieval system