KEGG   Bos indicus (zebu cattle): 109573322Help
Entry
109573322         CDS       T04792                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:biu00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    109573322
   04614 Renin-angiotensin system
    109573322
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    109573322
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    109573322
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109573322
Peptidases [BR:biu01002]
 Metallo Peptidases
  Family M2
   109573322
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109573322
CD molecules [BR:biu04090]
 Proteins
  109573322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
19
AA seq 751 aa AA seqDB search
MELDRDWATASSGSAVXLVMGTRWTCPGPSLLVLFCCAXAQGDQDSDQLYNETVAKAFLE
FYERTAQVVWNQFMAAAWNYVTNITKKNQEEMLYKDVEKSQHTLYFGTRARMFKIANFQD
SDVKRMLSKLLNVDKAALPKEELREYNEILAYMETTYSMAQVCLNEGPCLPLEPDLEEVM
ATSRDQKELLWAWQGWRDAVGRQLRMTFERYVQLSNKAANLNGYQDMGALWRSKYESDTL
QEDLEQLFQELQPLYLNLHAYVRRALYRFYGPELIDLRGPIPAHILGNMWAQSWVNILDL
ALPFPEKPPEDITKIMQGQHWKPEKMFQEAEKFFTSMGLLSTPPEFWKNSMMERPTDGRE
VECHASAWDFYNGKDFRIKKCTEVTIEDLLSIFHQMGHIQYFLQYKNLSVIFRAGANPAF
EEAMGSVVTLSASSHKHLLNRGLLSQQHQDKEEEVNFLMSVALEKIAFIPFAYLMDLFRW
KVFDGTIEKDVYNQEWWNLRLKYQGLCPPIPRTEEDFDPGAKFHISASLPYIRYFLSLVL
QFQFHEALCKASGHMGPLHRCDIYNSKEAGKLLEDVLKLGSSKPWPEVLEKMTGETKVST
KALMTYFKPLLNWLVTENVRQGEILGWPDFSCSFEERETSRAAFLGMELNSDQVKSWQWT
LLALSFVMLLAVLLLGXRLYTMEKSSLTQDTTSKTCFLGIAMEPHQVVKRQWMLLGLCLL
LMLCSIGLIIWIFTQHNRKPPWMRDEWGSWD
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaccgtgattgggccacagcctcctccggctctgctgttcktttggtcatg
ggaacaagatggacttgccctggcccttccctcctygtgctcttctgttgtgccrtggct
cagggtgaccaggactcagaccagctctacaatgagactgtggcaaaggccttcctggag
ttttacgagcgaacagcccaggttgtatggaaccagttcatggcggccgcctggaactat
gtcaccaacatcacaaagaaaaatcaagaggagatgctgtacaaggacgtggagaagtcc
cagcacacactgtactttggcacgcgggcccgcatgtttaagatcgccaacttccaggac
tcggacgtgaagcgcatgctgagtaagctgctgaacgtagacaaggcggccctgcccaag
gaggagctccgggagtacaacgagattctggcctacatggagaccacgtacagcatggcc
caggtctgcctgaatgaggggccctgcctgcccctggagcctgacctcgaagaagtcatg
gccacctcccgagaccagaaggagctgctgtgggcctggcagggctggcgggacgccgtg
ggtcgccagctccgcatgacctttgagcgctacgtgcagctcagcaacaaggctgcgaat
ctcaatggttaccaagacatgggggccttgtggaggtccaagtacgagtccgacacgctg
caggaagacctggagcagctgttccaggagctgcagccgctctacctgaacctgcatgcc
tacgtgcgcagggccctctaccgcttctatgggcccgagctcatcgacctgagggggccc
atccccgcccacatcctggggaacatgtgggctcagtcctgggtcaacatcttagacctg
gccctgcccttcccggagaagcccccygaggacatcacgaagatcatgcaaggccagcac
tggaagcctgagaaaatgttccaagaggctgaaaaattcttcacctccatggggctgctt
tccacccctcctgagttctggaaaaactccatgatggaaaggccaactgacgggcgggag
gtggagtgccacgcgtccgcctgggacttctacaacgggaaggacttcaggataaagaag
tgcaccgaagtgaccatagaagacctgctgtccatcttccaccagatgggccacatccag
tacttcctgcaatacaagaacctctcggtgatcttccgcgcaggcgccaacccagccttc
gaggaggccatggggtcggtggtcaccctttcagcctcttcccacaagcacctgctcaac
agaggcctgctcagccaacagcaccaggacaaagaggaggaggtcaatttcctgatgagc
gttgccctggagaagatcgccttcatccccttcgcctacctgatggacctgtttcgctgg
aaggtctttgacggcaccatcgagaaggatgtgtacaaccaggagtggtggaacctcagg
ttgaagtaccagggcctgtgccctcccatccctcggacagaggaggactttgatccaggc
gccaagttccacatctctgccagcttgccctacatacggtactttctcagcctcgtgctc
caattccagttccatgaagcactctgcaaggcctcgggccacatggggccgctgcaccgc
tgtgacatctataactccaaggaggcygggaagctcctggaggatgtcctgaagctgggc
tcgagcaagccctggccagaggtcctggagaagatgaccggggagaccaaggtgtctaca
aaggccctcatgacctacttcaagcccctgctgaactggctggtcactgagaacgtgcgg
cagggggagatactgggctggccagacttcagctgttcctttgaagaaagagaaacaagc
agggcagcattcctggggatggagctgaactctgaccaggtcaaatcctggcagtggacg
ttgctggccctgagctttgtcatgttactggcagtcctgctgctgggccrcaggctgtac
accatggaaaaaagctcactgacccaagacaccacatcgaaaacctgctttctgggcata
gcgatggagccccaccaagttgtcaagagacagtggatgctgctgggcctctgcctcctc
ctgatgctgtgctccattggcctcatcatttggattttcacacagcacaacaggaagcct
ccgtggatgagagatgaatgggggagctgggactag

DBGET integrated database retrieval system