Bos indicus (zebu cattle): 109574783 Help Entry 109574783         CDS       T04792                                  Name (RefSeq) histone H2B subacrosomal variant   KO K11252   histone H2B Organism biu  Bos indicus (zebu cattle) Pathway biu04613   Neutrophil extracellular trap formation biu05034   Alcoholism biu05203   Viral carcinogenesis biu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:biu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109574783  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     109574783   09163 Immune disease    05322 Systemic lupus erythematosus     109574783   09165 Substance dependence    05034 Alcoholism     109574783  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109574783   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109574783 Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109574783 Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109574783 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa TAF Motif Other DBs NCBI-GeneID:  109574783 NCBI-ProteinID:  XP_019838306 UniProt:  A0A6P5DJH9 LinkDB All DBs Position 20:complement(9516340..9516866) Genome browser AA seq 122 aa AA seqDB search MARNVTKRNKRCRGHQKAIYKKKSHSSSESGLRNYSLYINRVLKEVVPQKGISSRTIDII NTMINDMFERISTEACNLMYYRKRCTLTPEDIEKAVYLLLPEKLAKYAVAFGKEAVQRYV RS NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggccagaaacgtcaccaagaggaacaagcgctgcagaggacaccaaaaagcaatctac aaaaagaaatcacattccagctctgaatctggccttaggaattactcactctacataaac agggtcctaaaagaagtggttccccagaagggcatatcatctcgaaccattgacatcata aacaccatgatcaatgacatgtttgagcgcatttccactgaagcctgcaacctaatgtat tacaggaaacgctgtaccctcacccctgaagacatcgagaaggcagtgtatttgctgctg cctgagaaactggctaagtatgcagtggctttcggaaaagaagctgtccaacgatatgtc cgctcctaa

DBGET integrated database retrieval system