KEGG   Bos indicus (zebu cattle): 109575778Help
Entry
109575778         CDS       T04792                                 

Gene name
TGM5
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 5
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
biu  Bos indicus (zebu cattle)
Brite
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     109575778 (TGM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
21
AA seq 715 aa AA seqDB search
MAEGLEVALTDLQSSWNNVQHHTDEISSSRLLVRRGQAFNITLYFRNRAFQPGLDNIIFV
TETGPLPDLSKGTRAVFSLEGHPGSSPWIASLQTIGANSLEVSLCAPPMAAVGRYLLKVH
IKSLQGPVTAYXLGEFILLFNPWCPEDAVYLESEPQRQEYVMNDYGFIYQGNKNWIRPCP
WNYGQFEENIIDICLELLDKSLNFQIDPATDCALRGSPVYISRVVSAMINSNDDNGVLNG
NWGENYSDGTNPTEWMGSVAILKQWHATGCQPVRYGQCWVFAAVTCTVMRCLGIPTRVIT
NFNSGHDTDGNLIIDEYYDNTGRILENKKKDSVWNFHVWNECWMARNDLPPGFGGWQVLD
ATPQETSNGLYCCGPASVRAIKEGEVDLNYDTAFAFSMVNADCMAWLVFGGKEQKLHQDT
STVGNFISTKSIQSDERDDITENYKYREGSLQERQVFLKALQKLKAGRSPGSLRTESQPR
SVPLSDSPRSLATPSLQPSDVVQVSLKFQLLDSPDMGQDIRFVLLALNMSPQFKDLRVNL
SAQSLLHDGSPLLPFWQDTAFITLSPEEAKTYPCKITYSQYSQYLSTDKLIRISALGEEK
NSPEKILVKKIITLAYPSIMINVLGAAIVNQPLSIQVVFSNPLSEQVEDCVLTVEGSGLF
RRQQRVLIGVLKPHHRASLTLETIPFKSGQRQIQANLRSNKFKDIKGYTNVYIGL
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagggctggaggtggccctcaccgacctccagagctcctggaacaatgtgcag
caccayacagacgagatcagctccagtcgcctccttgttcgccggggccaggccttcaac
atcaccctgtacttcaggaaccgggccttccagccaggcctggacaacatcatctttgtg
actgagactggaccactgccagatctgtccaaggggactcgagccgtgttcagcctggaa
ggtcaccctggctccagcccctggattgcctcactgcagaccattggggccaattccctg
gaggtgagcctgtgtgcccctcctatggcagctgtgggtcggtacctcttgaaggttcac
atcaaatccctacaggggcctgtcacagcctacmagctcggggagttcatcctgctcttc
aatccctggtgcccagaggatgctgtctacctggagagtgaaccccagaggcaggaatat
gtcatgaatgattatggcttcatctatcaagggaacaagaactggatccgcccctgcccc
tggaattayggacaatttgaagagaatatcatagacatctgtctggagctgctagacaag
agcctgaacttccagattgacccagccacagactgtgccctacggggcagcccggtctac
atcagcagagtggtgtccgccatgatcaacagcaacgatgacaatggggtgctcaatgga
aactggggcgagaattactcagatggcaccaaccccacagagtggatgggcagcgtggcc
atcctgaagcagtggcatgccacgggctgccagccagtgcgttacgggcagtgctgggtc
tttgctgctgtcacatgcacagtgatgaggtgtctggggatccccacccgagtgatcacc
aacttcaactctggccacgacacagacggaaacctgatcattgatgagtattatgacaac
acaggcaggattttggagaataagaagaaggacagtgtctggaatttccaygtctggaat
gaatgctggatggcacggaacgacctcccacctggattcggaggctggcaggtgctggac
gctacacctcaggagacaagcaatggcctctactgctgcggccctgcctccgtcagagcc
atcaaagaaggagaggtggatctgaactacgacacagccttcgccttttccatggtgaat
gctgactgtatggcctggctggtctttggagggaaggagcagaaacttcaccaggacacc
agtactgttggtaattttattagcaccaagagcatccagagtgatgagcgggatgacatc
acggaaaactacaagtatagagaaggttctctgcaggagaggcaggtgtttctgaaggct
cttcagaagctgaaggctggaaggtccccaggctccctccgaacagaatcgcaacctagg
tccgtgccactgagtgacagtccgcggagcctggctactccttctctccagcccagtgat
gttgtccaggtctccctgaaattccagctgctcgattcgccagacatgggccaggacata
aggtttgtcctgctggccctcaacatgtcgccccagttcaaggacctcagagtgaacctg
agtgcccagtctctgctgcatgacggcagccccctgctcccattctggcaggacacagcc
ttcatcacactctctcctgaagaagcaaagacctatccctgcaaaatcacctattcccag
tacagccagtacctgtccacagacaagctgatccgcatcagtgccctgggtgaagagaag
aacagtcctgaaaagatcctggtgaagaagatcatcaccttagcctatcccagcatcatg
attaatgttttaggagcagccattgtgaaccagccgctctctatacaggtggtattttca
aaccccctctcggagcaggttgaagactgtgtgctgactgtggaaggaagcggtctcttc
aggagacagcagagagtcctcattggagtcctcaaaccccatcacagagccagtctcact
ctggagactatccccttcaagagtggccaaaggcaaatccaagcgaatctgaggagcaac
aaatttaaggacatcaagggttacacaaatgtctatattgggttataa

DBGET integrated database retrieval system