KEGG   Bos indicus (zebu cattle): 109578538Help
Entry
109578538         CDS       T04792                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00250  Alanine, aspartate and glutamate metabolism
biu00280  Valine, leucine and isoleucine degradation
biu00410  beta-Alanine metabolism
biu00640  Propanoate metabolism
biu00650  Butanoate metabolism
biu01100  Metabolic pathways
biu04727  GABAergic synapse
Module
biu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:biu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    109578538 (ABAT)
   00650 Butanoate metabolism
    109578538 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109578538 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    109578538 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109578538 (ABAT)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    109578538 (ABAT)
Enzymes [BR:biu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     109578538 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     109578538 (ABAT)
Amino acid related enzymes [BR:biu01007]
 Aminotransferase (transaminase)
  Class III
   109578538 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Lenti_VIF_2 Tex_N
Motif
Other DBs
NCBI-GeneID: 109578538
NCBI-ProteinID: XP_019843405
LinkDB All DBs
Position
25
AA seq 500 aa AA seqDB search
MASMLLTQRLVCSFQHNYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALMKLVQQPQ
NMSTFINRPALGILPPENFVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYR
SKERGQSSFSKEELETCMVNQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGG
DNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEELRPNAPYRIFNTWLGDPSKNLLLAXVINVIKREDLLNNAAHAGKVLLTGLL
DLQAXFPQLISRVRGRGTFCSFDTPDESVRNKLISIARNKGLMLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatgttgctcacccagcggctggtctgcagcttccagcacaactaccgcctg
ttggtgccgggatccagacacatcagtcaggctgcagccaaagttgacgttgaatttgac
tatgatggacctttgatgaagacggaagtcccagggcctagatctcgggagctaatgaaa
cagttgaatataattcagaatgcagaggctgtgcactttttctgcaattatgaagagagt
cgaggcaattacctggtggatgtggacggcaaccggatgttggatctttattcccagatc
tcctcggtccctataggttacaaccatcctgctctcatgaaactcgttcaacagcctcaa
aatatgagcacattcatcaacagacctgccctcggaatccttcctccggagaactttgtg
gagaagctccgggagtccctgctctcggtggctcccaaagggatgtcccagctcatcacg
atggcctgcggctcctgctccaacgagaacgccttcaagaccatcttcatgtggtaccgg
agcaaggaaaggggccagtcgagtttctccaaagaggagctggagacgtgcatggtcaac
caggcccctgggtgccctgactacagcatcctctccttcatgggtgctttccacgggagg
accatgggttgcttagcaaccacgcactccaaagccattcacaagatcgacatcccctcc
ttcgactggcccatcgcaccgttcccacggctgaaatatcctctggaagagtttgtgaaa
gagaaccaacaagaagaggcccgctgtctagaagaggtggaggacctgatcgtgaaatac
cggaagaagaagaggacggtggccggcatcattgtggagcccatccagtctgagggcgga
gacaaccacgcgtcggacgacttcttccggaagttgagagacatctccaggaagcacggc
tgtgccttcttggtggacgaggttcagactggaggaggctgcaccggcaagttctgggcc
cacgagcactggggcttggatgacccsgcggacgtgatgaccttcagcaagaagatgatg
accgggggcttcttccacaaggaggagttgcggcccaacgctccttaccggatcttcaac
acgtggctgggagacccatccaagaacctgctgctggccraggtcatcaatgtcatcaag
cgagaggacctgctgaacaacgcagcccatgctgggaaggtcctgctcacaggactgctt
gacctccaggcccrgttcccccagctcatcagcagagtcagagggcgaggcaccttctgc
tccttcgacactccagacgaatccgtgcggaataaactcatttcaatagccagaaacaaa
ggcctgatgctggggggctgcggcgacaagtccatccgcttccgtcccactctggtcttc
cgagatcaccacgcccacctgttcctcaacatctttagtgacatcctagctgacttcaag
taa

DBGET integrated database retrieval system