KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2804Help
Entry
blr2804           CDS       T00109                                 

Gene name
nrtB
Definition
(RefSeq) nitrate ABC transporter permease
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    blr2804 (nrtB)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    blr2804 (nrtB)
Transporters [BR:bja02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    blr2804 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
3081777..3082673
Genome map
AA seq 298 aa AA seqDB search
MNMPATKIEVETATPAGSAAPVVAMTPKRPPRSEAYARMVRETAVRVIPPLVVIALLTLV
WELVCRRTGSALPPPSRVFKDTKELILDPFFDHGGIDKGLFWHLSASLQRVAFGYSLSAI
AGIALGVLVGQSVWAMRGLDPLFQVLRTIPPLAWLPLSLAAFRDGQPSAIFVIFITSIWP
IIINTAVGIRNIPQDYRNVAAVVQLNPLEFFGKIMIPAAAPYIFTGLRIGIGLSWLAIVA
AEMLIGGVGIGFFIWDAWNSSHISEIILALIYVGIVGFVLDRLIAGLGKIVTRGTATN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcctgccacgaagattgaggttgagaccgcgacacccgcgggaagcgccgcg
cccgtcgtcgcgatgacgccgaagcggccgccgcggagcgaggcttacgcgcgcatggtg
cgcgagaccgctgtgcgcgtcatcccgccgctcgtcgtgatcgcgctgctgacgctggtc
tgggagctggtctgccgccgcaccggctcggcactgccgccgccgtcgcgggtattcaag
gacaccaaggagctgatcctcgatccgttcttcgaccatggcggcatcgacaagggtctg
ttctggcatctctccgccagccttcagcgcgtcgccttcggctattcgctctccgcgatc
gccggcatcgcgctcggcgtgctggtcggccagtcggtctgggcgatgcgcgggctcgat
ccgctgttccaggtcttgcgcaccatcccgccgctcgcctggctgccgctctcgctcgcg
gcgttccgtgacggccagccctcggcgatcttcgtcatcttcatcacctcgatctggccg
atcatcatcaacaccgcggtcggcatccgcaacatcccgcaggactaccgcaacgtcgcg
gccgtcgtgcagctcaatccgctggagttcttcggcaagatcatgatcccggcggccgcg
ccctacatcttcaccggcctgcgcatcggcatcggtctgtcgtggctcgccatcgtcgcc
gccgaaatgctgatcggcggcgtcggcatcggcttcttcatctgggacgcctggaactcc
tcgcacatcagcgagatcatcctggcgctgatctatgtcggcatcgtcggcttcgtgctc
gatcgcctgatcgcgggcctcggcaagatcgtcacccgcggcaccgcgacgaactga

DBGET integrated database retrieval system