KEGG   Bradyrhizobium japonicum E109: RN69_09385Help
Entry
RN69_09385        CDS       T03509                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
bjp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bjp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RN69_09385
Enzymes [BR:bjp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RN69_09385
Transporters [BR:bjp02000]
 Other Transporters
  Pores ion channels [TC:1]
   RN69_09385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_N_4 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AJA60587
LinkDB All DBs
Position
1996214..1996804
Genome map
AA seq 196 aa AA seqDB search
MKIYGDTNSGNCLKVKWVCDKLALPYQWIEIDTRKGETRTPQFLKMNGAGQVPTVAFDDG
RTLAQSNAIIRYLARDSALVPRDAFTAAKMDEWLFWEQYSHEPYVAVCRFQLVYLGKEAS
ELDPDKVKRGYAALDRMEQHLAASRFFAGEEVSLADVSLLAYTRLAHEGGFDLGRHAAIR
RWIGEAEAWLGLPPAR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctacggcgacacgaattccggcaattgtctcaaggtgaagtgggtctgcgac
aagctcgcgctgccttaccaatggatcgagatcgacacccgcaagggcgagacgcgcacg
ccgcaattcctgaagatgaacggcgccggccaggtgcccaccgtcgccttcgacgacggc
cgcacgctggcgcagtccaatgccatcatccgctatctcgcccgcgacagcgcgctcgtt
ccgcgcgatgccttcactgcggccaagatggacgaatggctgttctgggaacagtacagc
cacgagccctatgtcgcggtgtgccgcttccagctggtgtatctcggcaaggaggcgtcc
gagctcgaccctgacaaggtcaagcgcggctatgcggcgctcgaccgcatggagcagcat
cttgcggcaagccgcttcttcgccggcgaggaagtttcgctcgccgacgtctcactgctc
gcctacacccgcctcgcgcatgaaggtggcttcgatctcggccgccatgccgccatccgt
cgctggatcggcgaggccgaagcctggctcggccttccaccggcgcgctga

DBGET integrated database retrieval system