KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_30130Help
Entry
BJ6T_30130        CDS       T01848                                 

Definition
(GenBank) hypothetical protein
Organism
bju  Bradyrhizobium japonicum USDA 6
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3108771..3110654
Genome map
AA seq 627 aa AA seqDB search
MALKFRSIDGSNNNRADPTLNQADTDFARLGPANFVDGVNEMTPGPNPREISNIVVAQTD
IGEEGPHLVDDAGVALSGMMYAWGQFIDHDLDLQKEGTGTDDISIKVPADDEFLPPGSMI
ALTRVAIDPATGGTGHPAAAINTVTGWLDGSQIYGSDAATAASLRTADGHMKVSAGDNLP
IVETENGNVFAAGDVRAQENPDLTALQVLFVREHNYQVDRLHEDHPNWSGDKLYETAKAI
TTAEMVNITYNEFLPHLLGEDAIKPYQGYDRTADARITEEFAGAAFRFGHSIVSDEISAI
SNLGAFTSEQTLAQSFFEDTATFKATGADGLLRHLSGDLANPLDAHIVDGLRNLLFDPPD
GMDLAAINIQRGHDLGLGTLNQTREALGLAPYTSFDQFSSDPATAAAFEKAYGSIDAVDL
WAGGLAEDHAPGAVIGPTFGIIIADQFTALRDGDRYYFENQGFDKQTLNEIKNTTLSDLI
LRDTDTTAMQSDAFVATERHSGTLGGVDPTGEQAAAGMAQLVVGSPGGDTLTGGDLDDTL
VAAGGRMTMTGGAGADTFVFDLGVLAGKHNTAVITDFDPKRDKLQFSNDVEVTKSSDHHG
GTLLQVGSETIDLLGVKPHEMHLHEWG
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaaattccgcagcatcgacggctccaacaacaatcgtgcggatcccaccttg
aaccaggccgacaccgactttgcgcggctggggccggcaaatttcgtcgatggggtcaat
gaaatgacgccaggtccgaatccgcgcgagatcagcaacattgtcgtggcgcagacggat
attggcgaggaaggcccgcatctggtggatgacgccggcgtcgcgctgtcaggcatgatg
tatgcgtggggccagttcattgatcacgatctggatctgcagaaggagggaacgggcacg
gatgatatctcgatcaaggtcccggctgatgacgagtttctgccgcccggcagcatgatc
gcgttgacgcgggtggcgatcgatcctgcgacggggggcaccgggcatccggcagccgcg
atcaatacggtgacgggttggctggacggatcgcagatctacggttccgacgcggccacc
gcggcgagcctgcgaacggccgacggccatatgaaggtgtcggcgggagacaatctcccg
atcgtcgagaccgagaacggcaacgtctttgcggccggtgacgtacgggcgcaggagaat
cccgacctgaccgccttgcaagtcttgtttgtgcgcgagcacaactaccaggtcgatcga
ctgcacgaggaccatccgaactggagcggcgacaagctatacgagacggccaaggccatc
accacggccgagatggtcaacatcacctacaacgagttcctgccgcatctgttgggcgag
gacgccatcaagccgtaccaaggctatgaccgcacggcggacgcgcggatcaccgaagag
tttgccggtgcggcctttcgcttcggtcactccatcgtctccgacgagatcagtgcgatc
agcaatctgggtgccttcacgtcggagcagacgctggcgcaatcgttcttcgaagacacg
gcgactttcaaggcgactggtgcggatggcctgctgcggcatctgtcgggggacctggcc
aacccgctggacgctcacattgtcgatggcttgcgaaacctcctgttcgatcctccggac
ggcatggatctggcagcgatcaatatccaacgcggccatgatcttgggctgggtacactg
aaccaaacccgggaggcgctggggcttgcgccttacaccagcttcgatcagttcagctct
gatccggcgacggcagcagcgttcgagaaagcctatggttcgatcgatgccgtcgatttg
tgggccggtggattggctgaggatcatgcgccaggagcggtcatcgggcccaccttcggc
ataatcatcgccgaccagttcaccgctttgcgcgacggcgatcgctactacttcgagaac
cagggcttcgataagcagaccctgaatgagataaagaacaccacgctgtcggacctcatt
ctgcgcgacaccgataccactgcgatgcagagcgatgccttcgtcgccaccgagcggcac
agcggcacgctgggcggcgtagacccgaccggagaacaggctgcagcaggcatggcgcag
cttgtggtcggatctcccggcggggataccctgactggcggagatctggacgacacgctg
gtcgccgcgggcggccgcatgaccatgaccggaggtgccggtgccgacacattcgtattc
gaccttggtgttctcgcaggtaagcacaacaccgcggtcatcaccgacttcgatcccaaa
cgggacaagctgcaattttcgaacgacgttgaggtcacgaagtcatctgaccatcatggc
ggaacgctgttgcaggtcggctccgagaccatcgacctgctgggcgtaaagccgcatgag
atgcatcttcacgaatggggataa

DBGET integrated database retrieval system