KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_31410Help
Entry
BJ6T_31410        CDS       T01848                                 

Definition
(GenBank) hypothetical protein
Organism
bju  Bradyrhizobium japonicum USDA 6
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: BAL08416
UniProt: G7DHI3
LinkDB All DBs
Position
complement(3219346..3220365)
Genome map
AA seq 339 aa AA seqDB search
MQLMEAESVAQLPRGAQWQYEPKWDGFRCLLIRERSRVSMQSKSGRDLVRYFPEIAAAAA
ALSPKTLTLDGELIIELDEGYSFDALLQRIHPAASRVKHLAKETPATFMVFDLLRSGARD
LSGLPLMKRRAALETLAGKAFQASGLFRLTPASRNYADAEAWLNSVNEDHDGVVAKRLDL
PYRGGTRDGMQKIKLLRSADCVVGGFRYAERKQGNRKVVGSLLLGLYDKGGLLHHVGFTS
GIRSSDRLALTDRLEKIVGLQSFTGNSPGGPSRWSTKRSAEWKAVRPTFVVEVSYDHVTG
DRFRHGTKVIRWRPDKKPSQCRMDQLRQRAATQTFRAAT
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcatggaagccgagtccgtcgcccaactgccacggggggcccagtggcaatac
gagccgaaatgggatggattccgttgtcttttgatccgcgaacgcagccgagtcagcatg
caatccaaaagcggccgtgatctggttcgttacttcccggaaattgccgcagccgcggcc
gccttgtcgccgaagacgctcaccctggatggtgagttgatcatcgagcttgatgagggc
tattcgtttgatgcgttgcttcaacgcattcatccggccgccagccgggtcaagcacctt
gccaaagaaactcccgcaaccttcatggtttttgacctgttgcgatcgggcgcgagagat
ctttcgggtctgccgcttatgaagcgccgcgccgctcttgaaacacttgcgggaaaggcc
ttccaggcgagcgggcttttccggctgacaccggcaagccgaaactatgcggatgccgag
gcctggctcaacagcgtaaatgaagatcatgatggcgtggtcgccaagcgcctcgaccta
ccctatcgaggcggcacccgagacggcatgcagaagatcaagctgctgcgatcggctgat
tgcgttgttggcggatttcgttatgccgagaggaagcagggcaatcgaaaagtcgttggc
tcgttgctgctcggcctctacgacaagggtggacttctgcaccatgtcggatttacgtcc
ggcatccgatcgtccgatcgactggctctcaccgatcggctggagaaaatcgtcgggttg
cagagcttcaccggcaattcaccgggcggtccaagccgctggtcgacaaagcgatcggct
gaatggaaagccgtgcgtccaactttcgtggtcgaagtatcctatgaccatgtgacgggc
gaccgctttcggcacggcacgaaagtcatccgctggcgtcctgacaagaagccctcgcaa
tgtcgcatggatcagcttcggcagagggcggccacacaaaccttccgagcagcgacgtag

DBGET integrated database retrieval system