KEGG   Bacillus kochii: CKF48_07530Help
Entry
CKF48_07530       CDS       T05194                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bko  Bacillus kochii
Pathway
bko00010  Glycolysis / Gluconeogenesis
bko00053  Ascorbate and aldarate metabolism
bko00071  Fatty acid degradation
bko00280  Valine, leucine and isoleucine degradation
bko00310  Lysine degradation
bko00330  Arginine and proline metabolism
bko00340  Histidine metabolism
bko00380  Tryptophan metabolism
bko00410  beta-Alanine metabolism
bko00561  Glycerolipid metabolism
bko00620  Pyruvate metabolism
bko00625  Chloroalkane and chloroalkene degradation
bko00903  Limonene and pinene degradation
bko01100  Metabolic pathways
bko01110  Biosynthesis of secondary metabolites
bko01120  Microbial metabolism in diverse environments
bko01130  Biosynthesis of antibiotics
Module
bko_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKF48_07530
   00053 Ascorbate and aldarate metabolism
    CKF48_07530
   00620 Pyruvate metabolism
    CKF48_07530
  Lipid metabolism
   00071 Fatty acid degradation
    CKF48_07530
   00561 Glycerolipid metabolism
    CKF48_07530
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CKF48_07530
   00310 Lysine degradation
    CKF48_07530
   00330 Arginine and proline metabolism
    CKF48_07530
   00340 Histidine metabolism
    CKF48_07530
   00380 Tryptophan metabolism
    CKF48_07530
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CKF48_07530
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CKF48_07530
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CKF48_07530
Enzymes [BR:bko01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CKF48_07530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra DUF3813
Motif
Other DBs
NCBI-ProteinID: ASV67192
UniProt: A0A248TGE7
LinkDB All DBs
Position
complement(1507427..1508854)
Genome map
AA seq 475 aa AA seqDB search
MRNYTKHYINGEWVTSTGSKTIDVINPATEEVMGKISSGTEEDLDKAVAAAKAAFPSFSQ
TSVEERIELLERICQEYEKRKDDIIEVITEELGSPVKRSNKVHYQMGLQHFRQAVEELKT
FKFEEERGNTLVRKEAIGVAGLITPWNFPTNQTSTKLASAFAAGSTVVLKPASNTPFAAM
ILAEIFEAAGLPKGVFNLVTGSGSTIGNGISSHPDIDFVSFTGSGEVGQKIMENAASTIK
KVSLELGGKSPLIVLDDADIKGAAKTAVALVAGNTGQVCTAATRTLIPKGMHDEFVEAVK
EVIENFPVGDPTSQDVQVGPLVDADQWERVQSYIKKGSEEGADLIAGGPGKPEGLEKGYY
TKITAFTNVKNDMTIAQEEIFGPVMSILTYDNLDEAMEIANDTIYGLAGYVYGGDRDTLQ
KVAKGIRAGQIQVNNSKTDFSAPFGGFKQSGIGREWGDFGIEEFLEPKSIIGYYA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaattatactaagcactatattaatggcgaatgggtcacatcaacgggatctaaa
accattgatgtcattaatccagcaacagaagaagtaatgggaaaaattagttcaggaaca
gaagaagatttagataaagcagtggcagcggccaaagctgcatttccatcattctctcaa
acatcagtagaagaaagaattgagttacttgagcgaatttgtcaagaatatgaaaaacgt
aaagacgatattatagaagtgattacagaagaactaggctctcctgttaagcgaagcaat
aaagtccattatcaaatgggtttacaacactttagacaagcggtagaggaattaaagacg
ttcaaatttgaagaagaacgaggcaacacattagttcgcaaggaagcgattggtgtagca
ggactcataacaccatggaacttccctacgaatcaaacctctactaaactggcaagtgcg
tttgctgctggtagtaccgtagtgcttaaaccagcatctaatacaccatttgcagcgatg
attttagcggaaatctttgaagcggcaggtttgccaaaaggtgtctttaacctagtaaca
ggttcaggttcaacaatcggtaatggcattagttcacatcctgatattgatttcgtatcc
tttacaggatctggtgaagtcggacaaaaaattatggaaaacgcagcttcaactatcaag
aaagtttctcttgagttaggtggaaaatcaccacttatcgtgttagatgatgcagacatt
aaaggagcggcaaaaacagccgttgcgctcgtcgcaggaaatacaggtcaagtttgtaca
gcggcaacaagaacactcattccaaaaggaatgcatgatgaattcgttgaggctgtaaaa
gaagtgattgaaaacttcccagtcggtgatccaacaagtcaagatgttcaagtgggtcct
cttgtcgatgcagatcaatgggaaagggtacaatcgtatattaaaaaaggatcagaagaa
ggagcagatttaattgccggtggtcctggaaaaccagaaggactggagaaaggttattat
acgaaaatcactgcttttacaaatgtgaaaaacgatatgacgattgcccaagaagaaatc
tttggaccagtaatgagtatcctcacatacgataacttggatgaagcaatggaaatcgct
aatgataccatttatggattagctggctacgtttacggtggcgatcgtgacacattacaa
aaagtggccaaaggcattcgcgctggacaaatccaagtcaataattcaaaaactgatttc
tcagcaccgtttggcggctttaaacaatcaggcattggacgtgaatggggagactttggt
atcgaagaatttttagaacctaaatccatcatcggctactatgcttaa

DBGET integrated database retrieval system