KEGG   Bacillus kochii: CKF48_07980Help
Entry
CKF48_07980       CDS       T05194                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bko  Bacillus kochii
Pathway
bko00473  D-Alanine metabolism
bko00550  Peptidoglycan biosynthesis
bko01100  Metabolic pathways
bko01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bko00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CKF48_07980
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CKF48_07980
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CKF48_07980
Enzymes [BR:bko01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CKF48_07980
Peptidoglycan biosynthesis and degradation proteins [BR:bko01011]
 Precursor biosynthesis
  Amino acid ligase
   CKF48_07980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ASV67261
UniProt: A0A248TGE6
LinkDB All DBs
Position
complement(1581831..1582907)
Genome map
AA seq 358 aa AA seqDB search
MTIKIGLLYGGKSAEHHVSMQTALAVIKALNTNKFDIYPIYISEEGQWIKGQQLTGPVET
VKELSFSEGQQLSPLALAPTLFESKESRPFDVIFPLLHGPNGEDGTVQGMLELLNLPYVG
NGVLSSSAGMDKVIMKNIFAQAGLNQVDYVWYLRGEWETAEEDAYRKVEDTIGYPCFVKP
ANLGSSVGISKCTNRSELHEAFVEAFKYDRKIIIEQGVDAREIELGVVGNDYPECSVAGE
IIPKDKNFYDYTAKYEDGNTILMIPADVTEAEYSELEAMAIKAFKALDCSGLVRADFFLT
KEGKVYINEVNTMPGFTPYSMFPLLWKHSGVEYPALIERLVNLAIERHQEKQKIKHTK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaagatcggacttttgtacggtgggaaatctgctgaacatcatgtttctatg
cagacagcgcttgccgtgattaaagcattaaacacaaataaatttgatatttatcctatt
tatatttcggaagaaggtcaatggatcaaggggcaacaacttactgggcccgtggagaca
gtgaaagaattatctttttcagaaggccaacagctatcacctttagcgttagcaccaacc
cttttcgagtcaaaagaaagtcgaccttttgatgtgatttttcctttattgcatggtcca
aatggggaagatggaacggttcaaggaatgcttgagcttttgaatttaccatatgtcgga
aatggcgtcctttcttcttcagcaggaatggataaagtgatcatgaaaaatatctttgct
caagctggattaaaccaagttgattatgtttggtaccttcgaggggaatgggaaactgcg
gaagaggatgcttatcgcaaagtagaagataccatcggatacccgtgctttgttaagcca
gcaaatttaggctcaagtgtagggattagcaaatgtacgaatcgtagtgagctccatgag
gcattcgttgaagcatttaaatacgaccgtaaaattattatcgaacaaggtgtagatgca
agagagattgaactaggtgtagtgggaaatgattatcctgagtgctctgttgccggtgaa
attattccgaaagataaaaacttctacgattatacggcaaaatatgaagatgggaataca
attttaatgattcctgctgatgttactgaagctgaatatagcgaattagaagcgatggca
attaaagcctttaaagcattagattgttcgggacttgttagagcggatttcttcttaaca
aaggaaggaaaagtctatataaatgaagtgaacacaatgccaggctttacaccatacagt
atgttcccattactttggaagcattcaggtgttgaatatccagcccttattgaacgtctt
gtcaacttagcaattgaaagacatcaagaaaaacaaaaaattaagcatacaaagtaa

DBGET integrated database retrieval system