KEGG   Bacillus krulwichiae: BkAM31D_08205Help
Entry
BkAM31D_08205     CDS       T04947                                 

Gene name
nanA_1
Definition
(GenBank) Sialidase A precursor
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
bkw  Bacillus krulwichiae
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:bkw00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BkAM31D_08205 (nanA_1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BkAM31D_08205 (nanA_1)
Enzymes [BR:bkw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BkAM31D_08205 (nanA_1)
Bacterial toxins [BR:bkw02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BkAM31D_08205 (nanA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1466576..1468978)
Genome map
AA seq 800 aa AA seqDB search
MKQSKMYGLMIFTFLLLPFLCLQAVTTVGAAEQPSPLLRYENLQLSTGTSKDLSEYVDEL
SDLDEGTIIVRFRYSGSSFMSLFSLSNNTLPDSHFHLYISPGTIGSENRYQGPDFPKSNI
HTRTSSVSLAENYVHTLALVVDKNQGYKYFLNGELVHSDQQSKIAFLDNIHSPNSAKLGK
TERSSGNEYLFNGNIDFAEVYSTPLDDQYLLEITGQTHHESLENPLPDDAFITEPSSIFY
PGFMDSNNYRIPALYYTMNGTLLAGIDRRVNHGGDSPNDIHAAVRRSFDQGETWETDGII
INAYPDQASNIDLAFTQDETNERIFALVDGFPNGAGLMGGFGNNAYKGTGFKEIDGNSYM
FLVDQDENEYTIREEGVVYNQHNEATNYRVDERRDLYLDDEKIDNIFSATTPLTPYKTSY
LELYFSDDEGETWTGPIDLNPETKEEWMIFLGVGPGNGIQLKEGTHKGRIVFPVYFLNDH
NRQASAVVYSDDNGKTWHRGESPNEGRLLPNGETIREKDFTNHSHEITEAQVVEIPNGQL
KMFMRNYSGFAQIATSFDGGETWHEEVVTEEALVAPYSQMSAIRFNGQIDGKEAIIFSSA
NHPNNRVNGTVRVGLIEEDGTYSNGETNYSIDWRYEQLVKEGHYGYSSLANLESGRIGLF
YEATANTNMDYIQFNTEFLKWDRFGDAPKPSIESVQLISQGAISPGQPIQLEVTMDEFVI
LTGTRSLFGTLAGHQLEFTFVDQLGNQRFLFEATAPQLPPRSYSLTLSVPESLLLYNVYG
NKLEDLEPIQSFNKKIAIRK
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaagtaaaatgtatggtttaatgattttcacatttttattgttgcctttttta
tgtttgcaagcggttacaacagttggtgctgcagaacaaccttcacccctacttcgatat
gagaatcttcaactaagcaccggaacaagcaaagatttatctgaatatgttgatgagctt
agtgacttagacgaaggaaccattatcgttcgcttccgctattctggttcatccttcatg
tctttgttctcactaagtaacaatacactcccagacagtcactttcacttatacatttca
cctggcacaatcggaagtgaaaatcgctatcaaggccccgattttccaaaaagcaacatt
catactcgcacaagctctgtttcattagccgaaaactacgttcatacccttgctctcgtc
gttgacaaaaatcaaggctataaatatttcttaaatggtgaattggtccattcagatcaa
caatcaaaaattgcttttctagacaacattcatagcccaaacagcgcaaaattaggaaaa
acggagcgctcatcagggaacgagtatttattcaatggaaatattgactttgccgaagtt
tattcaacaccacttgatgatcaatatcttcttgaaattaccggtcaaacgcatcatgaa
tcattagaaaatccactccctgacgatgcttttatcaccgaaccttctagcattttctac
ccaggatttatggattcaaacaactaccggattccagctttatactatacgatgaatgga
acactattagctgggattgatcgccgcgtaaaccacggaggcgattcacctaatgatatt
catgcagctgtgagaagaagctttgaccagggagaaacttgggaaacagatggaattatt
attaatgcctatccggatcaagcttctaacattgacttagctttcacacaagatgaaacg
aatgaacgtatctttgctttagttgatggctttccaaatggagcaggcttaatgggtggc
ttcggcaataatgcctataaaggaacaggctttaaagaaattgatggcaactcatatatg
tttttagtcgatcaagatgaaaacgaatatacgattcgagaagaaggcgttgtgtataat
caacataatgaagcgacaaattatcgcgtagatgagcgtcgcgacctttaccttgacgat
gaaaagatcgataacatcttcagtgcaacaacacctttaacaccttataaaacttcttac
ctcgaactctactttagtgatgatgaaggagaaacttggacaggaccgattgatctaaat
cctgaaacaaaagaagaatggatgatttttttaggagtaggacctggtaacggaattcaa
ctgaaagaaggaactcacaaaggacggattgtctttcctgtctacttcctaaatgaccat
aatagacaggcaagtgctgtagtctatagtgatgataacgggaaaacttggcatcgaggg
gaatcacctaatgagggaagattattaccgaacggagaaacaataagagaaaaagatttc
actaaccactctcatgaaataactgaggctcaagttgtcgaaataccaaacgggcaatta
aaaatgttcatgagaaactattcaggttttgctcaaattgctacaagctttgatggcgga
gaaacatggcatgaagaagttgtaacagaagaagcactcgttgcaccttatagtcaaatg
tctgctattcgtttcaatggacagatagatgggaaagaagcgattattttctcaagtgca
aaccaccctaacaaccgagtaaatggaacggtgagagttggattaatagaagaagacgga
acgtatagcaatggagaaacaaactatagcattgattggcgttatgagcagcttgttaaa
gaagggcattatggatattcaagtctggccaatttagagtctggtcgcattggccttttt
tatgaagcaactgctaatacgaatatggattatattcaatttaacacggaatttctaaag
tgggatcgttttggagatgcacctaaaccttctatcgaatccgtgcaactgatcagccaa
ggtgcgataagcccaggccaaccaattcaattggaagtgacaatggatgaatttgtcatc
ctcactggcacacgctcactctttggtacattagcaggacatcaactagagttcacattc
gtcgaccaattaggaaatcaacgctttctttttgaagctactgcaccgcaacttccacca
cgctcctattcgctaaccttatctgtaccagaaagtttgttgctttataatgtgtatggg
aacaaattagaagatttagagccaattcaaagcttcaataaaaaaatagctattagaaaa
taa

DBGET integrated database retrieval system