KEGG   Bacillus krulwichiae: BkAM31D_10520Help
Entry
BkAM31D_10520     CDS       T04947                                 

Gene name
sodA_2
Definition
(GenBank) Superoxide dismutase, Mn/Fe
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bkw  Bacillus krulwichiae
Brite
Enzymes [BR:bkw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BkAM31D_10520 (sodA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1933251..1934153
Genome map
AA seq 300 aa AA seqDB search
MNDQEKEIYQWVQDVKRIWNEQGSLIEAQVGYGKIKPFMNSLITLSNELQFPQSRSSDQD
RQVYLSELAHEVYDNWIDLEQVRAEVGASLDPVPIGGHKLPPLPYAYNDLEPYISEEIMR
LHHSKHHQSYVDGLNKAEEEMQKARKKRDYDLIKHWEREAAFHGAGHYLHTIFWNIMSPR
GGGQPSGELAAQINKDFGSFNKMKEHFSKAAEKVEAVGWALLVWSPRTHRLEILQAEKHQ
NLSQQDVIPLLVLDVWEHAYYLQYKNEREPYINNWWNLVHWPEVEKRYLQARNVRWETFK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatcaagaaaaggaaatttatcaatgggtgcaagatgtaaaaagaatttggaat
gagcaaggttcacttattgaggcacaagttggttatggaaagataaaaccatttatgaat
tcgttaatcactttatcgaatgaattgcaattccctcaatcacggagtagtgatcaagat
cgacaagtatatttaagtgaactagctcatgaagtatatgataattggattgatttagaa
caagtacgtgctgaggtaggagcgtcattagacccagtgccaattggaggtcataagctt
cccccgttgccttatgcttataatgacttggaaccttatatatctgaagagattatgagg
ctgcatcatagtaagcatcatcaaagttatgttgatggattaaataaagcggaagaagaa
atgcaaaaagcacgtaaaaaaagagattatgatttaattaagcattgggaaagagaagct
gcttttcatggagctggacattatttacacacaattttctggaatattatgagtccgcgt
gggggaggtcagccaagtggggagttagccgcgcaaattaacaaagattttggtagtttt
aataaaatgaaggagcacttctcaaaagcggctgaaaaagtggaagcggttggatgggcg
ttgttagtttggtcgcctcgaacacaccgtttagaaatattacaagcggaaaaacatcaa
aacttaagccaacaagacgttattccattattagttttggatgtttgggaacacgcgtat
tacttacaatataagaacgaacgtgaaccttatattaataattggtggaacttggttcat
tggccggaggtggaaaaaaggtatttgcaagcaagaaatgtaagatgggaaacatttaaa
taa

DBGET integrated database retrieval system