KEGG   Bacillus krulwichiae: BkAM31D_18680Help
Entry
BkAM31D_18680     CDS       T04947                                 

Gene name
pfkA_3
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bkw  Bacillus krulwichiae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bkw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BkAM31D_18680 (pfkA_3)
   00030 Pentose phosphate pathway
    BkAM31D_18680 (pfkA_3)
   00051 Fructose and mannose metabolism
    BkAM31D_18680 (pfkA_3)
   00052 Galactose metabolism
    BkAM31D_18680 (pfkA_3)
  Energy metabolism
   00680 Methane metabolism
    BkAM31D_18680 (pfkA_3)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BkAM31D_18680 (pfkA_3)
Enzymes [BR:bkw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BkAM31D_18680 (pfkA_3)
Protein phosphatases and associated proteins [BR:bkw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BkAM31D_18680 (pfkA_3)
Messenger RNA biogenesis [BR:bkw03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BkAM31D_18680 (pfkA_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3401267..3402226)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHDLEVYGVYYGYQGLINGDIVKMELGSVGDI
IHRGGTMLYTARCEEFKTLEGQQKAIEQLNKFGIEGLVVIGGDGSYQGALKLTEHGFPTI
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDLALWS
GLADGAETILIPEADYDMKDIIARLKRGQERGKKHSIIIVAEGIGSGFEFGDRIEEEMNL
ETRVTVLGHIQRGGSPTGFDRVLASRLGAKAVDLLLDGKAGVTVGIEKNELVYHDIKEAL
SRKHSIDLDMYKLSQQLSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggataggagttttgactagtggtggggattcacctggaatgaatgcagccatt
cgtgctgtcgttcgtaaggccatctatcatgatttagaagtgtatggagtttattatggt
tatcaaggattaattaatggggatattgttaagatggagcttggttctgttggtgatatt
attcaccgtggaggaacaatgctttatactgcgcgttgtgaagagttcaagacgttggaa
ggtcagcaaaaagctattgagcaattaaataaatttggaattgaagggcttgtcgttatt
ggtggagatggatcttaccaaggggctcttaaattaacagagcacggctttccaacaata
ggggtgccgggtaccattgataatgacattccaggtacagacttcacgattggttttgat
acggctttaaacactgtcattgatgcgattgataagattcgtgatacagccacatctcat
gagcgtacatatgtaattgaagttatgggacgtcatgctggagacttagcattatggtca
ggactagctgatggtgcagagactattttaattccagaagctgattatgatatgaaagac
attattgctcgactgaagcgcggacaagagcgtggaaagaagcacagtatcattatcgtt
gcggaagggattggtagtggttttgaatttggagatcgtattgaagaggaaatgaatctt
gaaacacgtgtaactgttttaggacatattcaacgtggtggttcacctacaggattcgac
cgcgttcttgcaagtcgccttggagcaaaagcggtggacttattgttagatggaaaagca
ggagtaacagtagggattgagaagaacgaacttgtctatcatgatattaaagaagctcta
tcaagaaagcattcaattgatcttgacatgtacaagctttctcaacaattatcgatttaa

DBGET integrated database retrieval system