KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00757Help
Entry
BLi00757          CDS       T00200                                 

Gene name
yfmT
Definition
(GenBank) putative aldehyde dehydrogenase YfmT
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00627  Aminobenzoate degradation
bld01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bld00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BLi00757 (yfmT)
Enzymes [BR:bld01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     BLi00757 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AAU39692
LinkDB All DBs
Position
766207..767664
Genome map
AA seq 485 aa AA seqDB search
MIQITDLNRQYIGGEWRDGQSESVLADLNPFTHKTIASFRKATREDVDAAYKAALEAKKK
WDGVNPYEKRAILEKAAAYIEDNREAIVFLIMEELGGTRLKAAFEIDLVVNMIKEAAGFP
LKMEGKILPSPVDGKENRIYRIPAGVVGVISPFNFPFFLSVKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFEEAGLPKGLLNVVVTDIGEIGDSFVEHPIPRIISFTGSTKVGSYIG
QLAIKHFKKPLLELGGNSALIVLEDADLEYAVNAATFSRFTHQGQICMSANRILVQKEVY
PEFLKLFSQKVSGLKTGDPLDPETVIGPVINERQAEHLRKSIEKGIEEGATPLLKGDIKG
NLVEPTILADVTPDMSVAKEELFGPVVCVMPFETEADAVEIANDTPFGLSGAVHTGNVES
GVAIAKQIETGMIHVNDTTINDEPHVAFGGEKQSGIGRLNGEWSLDEFTTLKWISVQHQK
RSFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaataactgacctcaaccgtcaatacataggaggggaatggagagacggccaa
agtgaaagcgtgttggccgatctgaatccttttacccataaaacgattgcctcttttcgg
aaagcgacgcgggaggatgtcgatgcggcttacaaagctgcgcttgaggcgaaaaagaaa
tgggatggcgtcaatccctatgaaaaaagggcaattttagaaaaagccgcggcttatatt
gaagacaatagagaagcgattgtgtttctcattatggaggagcttggcggaacacggctg
aaagcggcttttgaaatcgatcttgtcgtcaatatgatcaaagaagcggcgggcttcccg
ctcaaaatggaaggcaaaattctcccttcaccggttgatgggaaagaaaatcggatatac
cgcattccggcgggagtggtcggcgtcatcagtccgttcaattttccgttctttttatct
gtaaaatcagttgcgcccgcgcttggcgccgggaacggcgttgttttaaagccgcatgag
gaaacaccgatttgcggcggcacgctgattgcaaagatttttgaagaagccggtcttccg
aagggactgctgaatgtcgtggtcacagatatcggggaaatcggcgacagcttcgttgag
catccgattccgcgaatcatctcgtttaccggttcaacgaaggtcggcagctatatcggg
cagctggcgatcaaacatttcaaaaaaccgctgcttgaactcggcggaaacagcgccttg
atcgttctcgaggatgccgatttggaatacgccgtcaatgccgcgactttcagccgcttc
acacatcaagggcaaatctgcatgtcggccaaccggattcttgttcaaaaagaagtgtat
ccggaatttttaaagctgttcagccaaaaagtatccgggcttaaaacgggcgatccgctg
gaccctgaaaccgttatcggccctgttattaatgaacgccaagctgaacatttaagaaaa
tcgattgaaaaaggcatcgaagaaggcgccacaccgcttctgaaaggcgatattaaaggc
aatctcgtcgagccgacgattcttgcggatgtcacgcctgatatgtctgtcgccaaggaa
gagctgttcggtccggttgtatgcgtcatgccgtttgagaccgaagcagacgcggttgag
atcgcgaatgacacgcctttcggactgagcggagccgtacacacgggaaatgtggagagc
ggcgttgccatcgcaaagcaaatcgagacgggcatgatccatgtcaatgacacgacgatc
aacgatgagccgcatgtcgctttcggcggtgaaaagcaatcggggatcggaaggctgaac
ggagagtggagccttgacgaatttacgacattaaaatggatttccgtccagcaccaaaaa
aggagttttccatattaa

DBGET integrated database retrieval system