KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi01538Help
Entry
BLi01538          CDS       T00200                                 

Gene name
ligB
Definition
(GenBank) phage ATP-dependent DNA ligase LigB
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:bld00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BLi01538 (ligB)
   03410 Base excision repair
    BLi01538 (ligB)
   03420 Nucleotide excision repair
    BLi01538 (ligB)
   03430 Mismatch repair
    BLi01538 (ligB)
Enzymes [BR:bld01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BLi01538 (ligB)
    6.5.1.6  DNA ligase (ATP or NAD+)
     BLi01538 (ligB)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BLi01538 (ligB)
DNA replication proteins [BR:bld03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BLi01538 (ligB)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BLi01538 (ligB)
DNA repair and recombination proteins [BR:bld03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BLi01538 (ligB)
   NER (nucleotide excision repair)
    Other NER factors
     BLi01538 (ligB)
   MMR (mismatch exicision repair)
    Other MMR factors
     BLi01538 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1509475..1510284)
Genome map
AA seq 269 aa AA seqDB search
MFIWPMLLESAKEPFNSDDYITETKFDGIRLIASRNNGLIRLYTRHNNEVTAKFPELLTL
DIPDETILDGELIVPGSTGAGDFEAVMERFQSRKSFYPIVFCVFDVLRIEGVSVTSKPLS
ERKELLAGLKLDHPNVKIVEGVRGHATDYFELVRENKIEGIVMKQANAPYAENKRSDRWL
KIVNYEYTDVLISGLRKEDNALLLSYLDGQYAGIMEFMPYDARRKFHAERLIVEETEKYA
YIEPIGCRVKHRFKTKNGLLRIPSFHEWR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
ttgtttatttggcccatgctgcttgagtccgcaaaggagccgtttaactcggacgactat
atcacggaaaccaaattcgacggcatccgtctgatcgcgtccaggaataacggtttaatc
cgcctctacacacgccacaacaacgaagtcaccgctaaatttccggaactattaacgctc
gacataccggatgaaactattttagacggcgagcttatcgtacctggatcgacaggcgcc
ggcgattttgaggccgtcatggaacgattccagtcgcggaaaagtttttatccgatagta
ttttgcgtttttgatgtcctgcggatagaaggcgtttcagttacgtctaagccgctaagt
gaacgaaaagaattgctggccggtctaaaactcgatcatcctaacgttaaaatagtcgag
ggcgtgcgcggccatgctacggattatttcgaattagtccgcgaaaataagatcgagggc
atcgttatgaagcaggcaaacgctccgtatgcggaaaataagcggtcagatcgctggctg
aagatcgttaactacgaatatactgacgttctgatatcaggactccgcaaggaagacaat
gcgctgcttctttcgtacctggacggccagtatgccggcattatggagtttatgccgtat
gatgcgcggcggaagtttcatgcggagcggctaatcgtagaagaaacggagaaatacgcc
tacatcgagccaattgggtgccgcgtcaagcaccggttcaagacgaaaaacggtttgttg
cggattccttcgttccatgaatggcgttga

DBGET integrated database retrieval system