KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02679Help
Entry
BLi02679          CDS       T00200                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase SodA
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Brite
Enzymes [BR:bld01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BLi02679 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2583685..2584293)
Genome map
AA seq 202 aa AA seqDB search
MAYKLPELPYAYDALEPHIDKETMNIHHTKHHNTYVTKLNEAVAGKQDLESKSVEELVAN
LDAVPENIRTAVRNNGGGHANHSLFWKLLSPNGGGAPTGELAEAINSKFGSFDQFKEDFA
AAAAGRFGSGWAWLVVNNGELEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPD
YIKAFWNVVNWDEVARLYSEAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaaacttccagaattaccttatgcttacgatgcgttagaacctcacatcgac
aaagagacgatgaatattcaccatacgaagcaccataacacatatgttacaaaattgaac
gaagcggtggcaggcaaacaggatcttgaaagcaaatctgttgaagagcttgttgcaaac
cttgatgcagtaccggaaaacatccgtacagctgtccgcaacaatggcggagggcatgcc
aaccactcattgttctggaaacttctttctccaaacggaggaggcgctccaactggtgaa
ttggcagaagccatcaacagcaaattcggcagcttcgatcaattcaaagaagactttgcg
gctgcagcagcaggccgtttcggctccggctgggcatggcttgttgtcaataacggagag
cttgaaatcacaagcacgccaaaccaagattctcctctttcagaaggcaagactcctatc
ttaggtcttgatgtatgggagcacgcatactacctgaattatcaaaaccgccgtccagat
tacattaaagcattctggaacgtcgttaactgggatgaagttgcacgcctttacagcgaa
gcaaaataa

DBGET integrated database retrieval system