KEGG   Beggiatoa leptomitiformis: AL038_14795Help
Entry
AL038_14795       CDS       T04090                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
blep  Beggiatoa leptomitiformis
Pathway
blep00620  Pyruvate metabolism
blep00680  Methane metabolism
blep01100  Metabolic pathways
blep01120  Microbial metabolism in diverse environments
blep01200  Carbon metabolism
Module
blep_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:blep00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL038_14795
  Energy metabolism
   00680 Methane metabolism
    AL038_14795
Enzymes [BR:blep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AL038_14795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALG68732
LinkDB All DBs
Position
complement(3511631..3514441)
Genome map
AA seq 936 aa AA seqDB search
MKNLVKDKPLRRRVKLFGKLVGKVLRARAHGQVYATVEELRKGYIQLRKTPDSVKQHKLE
RMITLLSPEVLSEVIRAFNIYFSLTNIADELFKHQSRREQVHKGGALWEESFDATFREFI
KAGLSPQDIQSLFDNLLYTPVFTAHPTELRRRTLMLALRRVFLATEKLDQRGLSWVEHAE
LEAALEAELHILWKTDEVRLRQMHVEDEISNGLNYFRESLFTAVPLAYRAAERTIKRLYN
DTNQTPVVVPSFLRFGSWIGGDRDGNPFVKPATTVKALRLQKVEILREYERQLYDLSDII
THSKSFCQPSQALLESIEQDAGLLARNNLYTYSEHIFEIYRRKLSMMRIRIKNNLEATEA
RLNNALTGMVIADKERIGYTNEAEFLADLQLIYQSLLSHDDQAVADGALKDLIRSVETFG
FYLMKLDIRQESTRHTEAVTELLTAQNIDYNSLSENARLALLIQLLQTEQALLTNNTRWS
ELTAETLEVFQIVHDMRQEISPDAFGSYVISMTHSASHVLEVLLLAQQYKLVDKNGGYCY
IGVSPLFETIDDLNHIEHVLSTLFTQPFYRQLLRASGNTQEVMLGYSDSCKDGGIITSSW
LLHEAQKKITALAEANQLACRLFHGRGGAVGRGGGPTYEAIISQPAGTVHGQIKFTEQGE
VLAYKYSNPETAMYELTVGAAGLLKASSVLMHKHKSVDSRYIEIMNYLAKQGEKQYRLLT
DHTEGFMPFFYDATPVAEIGLMNIGSRPARRRSDNPSKYSIRAIPWVFGWSQARYTLPAW
FGLGTALEKFCDKDVDNLAKLQKMYVEFPFFKSLLSNIQMSLFKTEMDIARRYADLCSDK
RQAEKIFAMIEAEYVRSEQYLLQVANISELVADNPSLQLSIERRLPYIDPLNAIQVYLLG
QYRQTTASGNAEEAKRWFDPLIRSINAISAGMRNTG
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacctcgtaaaagataaaccgctgcgccgtcgagtaaaattattcggtaaatta
gtcggtaaggtcttacgcgcccgtgcgcatggacaggtttacgcaacggtagaagaatta
cgcaaaggctatattcaactcagaaaaacccctgatagcgtaaaacagcacaaattggag
cggatgatcacgttgttatcgcccgaggtgctatcagaagtcattcgtgcttttaatatt
tatttcagcctgaccaatattgctgatgaattatttaaacatcaaagccgccgtgaacag
gtacataaaggcggtgctttatgggaagaatcatttgatgcgacctttcgggaatttata
aaagcaggcttgtccccccaagatattcaatccttatttgataatttactttatacccct
gtttttactgcacatccaacagaattacgtcgtcgtactttaatgttagccttacggcgc
gtttttttagccacggaaaaacttgaccagcgtggcttaagttgggtagaacacgctgaa
ttagaagcggcattggaagcggaattacacattttatggaaaaccgacgaagtgcgtttg
cgccagatgcacgttgaagatgaaatcagtaatggcttgaattatttccgtgaaagtcta
tttacagccgttcccctcgcctatcgtgcggctgaacggactatcaaacgcttatataac
gatacaaatcaaaccccggttgttgtacccagttttctacggtttggctcgtggattggt
ggcgatagagatggcaaccccttcgtaaaacccgcaacaacagttaaagccctacggctg
caaaaagtcgagattttgcgcgagtatgaacggcaattatatgatttaagcgatattatc
acgcactcaaaatccttttgccaacccagtcaggccttattagaaagtattgaacaagat
gcaggattattagcccgtaataatctttatacctacagcgaacatatttttgaaatttat
cggcgtaaattatcaatgatgcgtatccgcattaaaaataatttagaagcaacagaagcc
cgtttaaacaatgcattaacaggcatggtgattgcggataaagaacgcattggttatacc
aacgaagcggagtttctggctgatttacagttaatttatcagtcattattaagtcatgac
gaccaagcggttgccgacggcgcgctaaaagatttaattcgttcagtggaaacatttggg
ttttatttgatgaaattagatattcgtcaagaatccacccgccacacagaggcagttact
gagttattaacggcacaaaatattgattataatagcttatcagaaaatgcgcgtttagca
ttactgattcagctattgcagacggaacaggcgttattaaccaataatacgcgatggtca
gaactgacggcagaaacgctagaagtctttcaaattgttcatgatatgcgccaagaaatc
agccctgatgcctttggaagttatgttatttccatgacgcatagcgcaagccatgtatta
gaggttttattattagcgcaacagtataaattggttgataaaaatgggggatattgttat
atcggcgtatcccctttgtttgaaacaattgacgatttaaaccatatagaacacgtttta
agcacgttatttacccagcctttttatcggcaattgttacgggcttctggcaatacgcaa
gaagtcatgctgggttattccgattcgtgtaaagatggcggtattatcacatcctcatgg
ttattacacgaagcacagaaaaaaatcaccgcgttagcagaagccaatcaactggcatgt
cgtctatttcatggacgcggtggcgcggttgggcggggcggtggccctacttatgaagcg
attatttcgcaaccagcaggcacagtacatgggcaaatcaaatttactgagcagggcgag
gtgttagcgtataaatacagtaatcctgaaaccgccatgtatgaattgaccgttggcgcg
gcaggtttgcttaaagccagcagtgtgttaatgcataagcataaatccgttgatagccgt
tacatagaaattatgaattaccttgcaaaacaaggggaaaaacaatatcgcttgttgacg
gatcacacggaaggttttatgccatttttctatgatgcaacgcctgttgctgaaattggc
ttgatgaatattggctcacgccctgcacgtcgtcgttctgataacccatcaaaatattcc
attcgtgctattccttgggtttttggctggtcacaagcacgttatacattgcctgcatgg
tttgggttgggaacagcattagagaaattttgtgataaagatgtggataatttagcaaaa
ttgcaaaaaatgtatgttgaatttccgttttttaaatcgttgttaagcaatattcaaatg
tctttatttaaaacagaaatggatattgcccgtcgttacgcagatttatgtagcgataag
cgacaagcggaaaaaatctttgccatgatagaagcggagtatgttcgttctgaacaatat
ttgttgcaagtggcgaatattagcgaattggttgcagataacccatcgttacaattgtcg
attgaacggcgattaccgtatatagacccactcaatgcaatacaggtttatttattggga
caatatcgccaaaccactgcaagtggtaatgctgaagaagccaaacgttggtttgacccc
ttgattcgttctattaatgcaatttcagcgggaatgcgtaatacaggttaa

DBGET integrated database retrieval system