KEGG   Bacillus paralicheniformis: BaLi_c27670Help
Entry
BaLi_c27670       CDS       T02694                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase SodA
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
blh  Bacillus paralicheniformis
Brite
Enzymes [BR:blh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BaLi_c27670 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2751321..2751932)
Genome map
AA seq 203 aa AA seqDB search
MMAYKLPELPYAYDALEPHIDKETMNIHHTKHHNTYVTKLNEAVAGKQDLESKSVEELVA
NLDAVPENIRSAVRNNGGGHANHSLFWKLLSPNGGGAPTGELAEAINSKFGSFDQFKEDF
AAAAAGRFGSGWAWLVVNNGELEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRP
DYIKAFWNVVNWDEVARLYSEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatggcttacaaacttccagaattaccttatgcttacgatgcgttagaaccacacatc
gacaaagagacgatgaatattcaccatacgaagcaccataacacatatgttacaaaattg
aacgaagcggtggcaggcaaacaggatcttgaaagcaaatctgttgaagagcttgttgca
aaccttgatgctgtaccggaaaacatccgctcagctgtccgcaacaatggcggtggacat
gccaaccactcattgttctggaaacttctttctccaaacggaggaggcgctccgactggt
gaattggcagaagcgatcaacagcaaattcggcagcttcgatcaattcaaagaagacttt
gccgctgcagcagctggccgtttcggctccggctgggcatggcttgttgtcaataacgga
gagcttgaaatcacaagcacgccaaaccaagattctcctctttcagaaggcaagacccct
atcttaggtcttgacgtatgggagcacgcatactacctgaattaccaaaaccgccgtcca
gattatattaaagcattctggaacgtcgttaactgggatgaagttgcacgcctatacagc
gaagcaaaataa

DBGET integrated database retrieval system