KEGG   Bacillus paralicheniformis: BaLi_c31490Help
Entry
BaLi_c31490       CDS       T02694                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
blh  Bacillus paralicheniformis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:blh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BaLi_c31490 (pfkA)
   00030 Pentose phosphate pathway
    BaLi_c31490 (pfkA)
   00051 Fructose and mannose metabolism
    BaLi_c31490 (pfkA)
   00052 Galactose metabolism
    BaLi_c31490 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BaLi_c31490 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BaLi_c31490 (pfkA)
Enzymes [BR:blh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BaLi_c31490 (pfkA)
Protein phosphatases and associated proteins [BR:blh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BaLi_c31490 (pfkA)
Messenger RNA biogenesis [BR:blh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BaLi_c31490 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3141876..3142835)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLEIGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIANLKKYGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDLTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAESILIPEADYDMEEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEATNL
ETRVSVLGHIQRGGSPTAADRVLASRLGAFAVELLLEGKGGRCVGIQNNQLVHHDIIEIL
DHKHTIDQSMYRLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtatcggagtattgacgagcggcggagattccccgggaatgaacgcggcggtc
cgcgcggttgtcaggaaagcaatctaccatgacgtagaagtatacggaatttacaacggg
tattcaggtttaatcagcggaaaaatagaaaagcttgaaatcggttctgtcggagatatc
attcaccgcggaggaacgaagctatatacagcaaggtgtcctgagtttaaaacggtagaa
ggacgggaaaaaggaatagcgaatttaaaaaaatatggtatagaaggattagtcgtcatt
ggcggagacggttcttatatgggagcgaaaaagctgacagaacacggttttccttgtgtc
ggagtgccgggaacaatcgacaatgacatccctggaacagatttgacgatcggatttgat
acggcgttaaataccgttatcgatgccatcgataaaatcagggatacagctacatcccac
gaacgtacatacgtgattgaagtaatgggccgccatgccggggacattgctttatggtca
ggtttggcaggaggcgcggaatccattttgatccctgaagctgactacgatatggaagaa
attattgcgaggctgaaaagagggcatgagcgcggcaaaaaacacagcatcatcattgtg
gcggaaggcgtcggaagcggcgttgaattcggcaaaagaattgaagaagccacaaatctc
gaaactagagtatcggtgcttggacatatccagcgcggcggttctccgactgcagcagac
cgtgtattggcaagccgtctaggggcatttgcggttgaactgcttcttgaaggaaaaggc
ggacgctgtgtcggaattcaaaataaccagcttgtgcatcatgatatcattgaaatactc
gatcataaacatacaattgatcaaagcatgtaccgcttgtctcaagaactgtcaatctag

DBGET integrated database retrieval system