KEGG   Bacillus licheniformis ATCC 14580: BL01452Help
Entry
BL01452           CDS       T00197                                 

Gene name
odhA
Definition
(GenBank) 2-oxoglutarate dehydrogenase (E1 subunit)
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00020  Citrate cycle (TCA cycle)
bli00310  Lysine degradation
bli00380  Tryptophan metabolism
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01120  Microbial metabolism in diverse environments
bli01130  Biosynthesis of antibiotics
bli01200  Carbon metabolism
Module
bli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BL01452 (odhA)
  Amino acid metabolism
   00310 Lysine degradation
    BL01452 (odhA)
   00380 Tryptophan metabolism
    BL01452 (odhA)
Enzymes [BR:bli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BL01452 (odhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N DUF4892
Motif
Other DBs
NCBI-ProteinID: AAU23783
UniProt: Q65IH4
LinkDB All DBs
Position
complement(2217493..2220327)
Genome map
AA seq 944 aa AA seqDB search
MFQNSMKQRMTWEEFHGPNLGYVLELYDQYVKDPESLDADLKEMFDELGAPPGDIRAASQ
KNEEADFTAGSIQKIASAVKLAEDIRTYGHLNASVNPLRKTQEKQELFPLAEYGLTEQDV
KKIPASVICKDAPKEVTNGLEAIQYLRNTYKKSISFEFDHVHIFEERNWLMKKIESGELF
TPKSKEKLVEVLRRLTEVESLEQFLHKTFVGQKRFSIEGLDALVPMLDDIIAKSVSAGTT
NVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSTGINYGWTGDVKYHLG
ANRQIQDEHTKTARIALANNPSHLEFIDPIVEGSTRAAQETRTESGYPVQDVKKSMAILI
HGDAAFPGEGIVAETLNLSQLKGYQVGGAIHIIANNMIGFTTESNESRSTKYASDLAKGF
EIPIVHVNADDPEACLSAVQLAVEYRMTFNKDFLIDLIGYRRFGHNEMDEPSATQPMLYD
AVRKHPTVKNIFAEKLIHKGIVDKETVGKIKDAVQKRLEEAYRKVPAKKEDMTHEIVLPE
PVSNGFPDVDTSVDFETLRKINQELVSWPENFNVFDKLKRILERRAKAFEDDRKVDWSLA
EAMAFASILKDGTPLRLTGQDSERGTFAHRNLVLHDSKTGDEFIALHHLADTKASFAVHN
SPLSEGSVLGFEYGYNVSSPETMVIWEAQFGDFANAAQVYFDQFISAGRAKWGQKSGLVV
LLPHGYEGQGPEHSSGRTERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
IIMTPKSLLRNPNTVSEVQELSNSSFKPVYEMSGLSHQYDKVTRLVLSSGKVSIDISDHF
NKMEGEKDWLHIARVEELYPFPAKHIKAIFSKLPNLEEIVWVQEEPQNMGAWNYIEPYLR
EVAPKDVKVRYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaatagtatgaaacaaagaatgacttgggaagaatttcacggtccgaacctc
ggctatgtgctggagctttacgatcagtacgtcaaggatccagaaagcttggatgctgat
ttaaaagagatgtttgacgaacttggagctcccccgggcgatattagggccgcctctcaa
aaaaacgaagaggcagatttcacggctggatctattcaaaaaatcgcatcagcggtaaaa
cttgcagaagatattagaacctatggccatttaaacgcttccgtcaatccactgagaaaa
acacaagagaaacaggagctttttcctcttgctgagtacgggttaactgagcaggatgtg
aaaaaaatcccggcgtctgtcatatgcaaagatgcccctaaagaagtaacgaacggttta
gaagccatccagtacttaagaaacacatacaaaaaatcgatttcttttgaatttgaccat
gtgcacatttttgaagagcgcaactggctgatgaaaaagatcgaatccggggaattattc
accccgaaatcgaaagaaaaactggtagaagttttaagaaggcttacagaagtggaaagc
cttgaacagtttctccacaaaacctttgtcgggcaaaaacgcttttcaatagaaggactt
gatgcgcttgtgcccatgctggatgatattatcgccaagtccgtttcggcaggtacgaca
aacgtcaatatcggaatggcgcacaggggccgcctgaatgttcttgcgcatgtgctcgga
aaaccttatgaaatcattttttctgaattccagcatgcgccgaacaaagatctcgttccg
tcggaaggttcgaccgggatcaattacggctggacgggcgacgtaaaataccacctcggc
gccaaccgccagattcaggatgagcatacgaaaacggcgcgcattgcgctcgcgaacaat
ccgagccaccttgagttcatcgatccgatcgttgagggatcgacaagagccgcccaggaa
acgagaacggagagcggctatccggttcaagacgtcaaaaaatcgatggcgattctgatt
cacggcgatgcggcattcccaggggaaggcattgtcgcggaaacgctgaatttaagccag
cttaaagggtatcaagtgggcggagcgattcacattatcgccaataacatgatcggcttt
acgacggaaagcaatgagtcaagatcgacgaaatatgcaagcgaccttgcgaaaggtttt
gaaattccgatcgtccacgtcaatgctgatgatcccgaagcatgtctttcagcggttcag
ctcgctgttgaataccgcatgactttcaacaaagactttttgatcgatctgatcggctac
cgccgttttggccacaatgaaatggatgagccgtccgcaacgcagccgatgctgtatgat
gcggtcagaaagcatccgaccgtcaaaaacatctttgctgaaaagctgattcataaaggg
atcgtcgataaagaaaccgtcggcaaaatcaaggacgctgtccagaagcgtttagaagaa
gcctatcgcaaagtgccggccaaaaaggaagacatgacgcatgaaatcgtacttccagag
ccggtctccaacggttttcctgatgttgacacatcggttgattttgaaactttgcgcaaa
atcaatcaggagcttgtttcatggccggaaaacttcaacgttttcgataagctaaaacga
atccttgaaaggcgcgccaaagctttcgaagatgaccgaaaagtcgactggtcgcttgca
gaggcgatggcgtttgcgtcgattttgaaagacggtacgccgctaaggctgaccgggcag
gattcagaacgcggcacattcgcacaccgcaaccttgtccttcacgacagcaagacaggg
gacgaattcatcgcgctgcatcaccttgccgatacgaaagcgtcatttgcggttcacaac
agcccgctttctgaagggtccgtcctcggcttcgaatacggctataacgtgtcttcgccg
gaaacgatggtgatctgggaagcgcagtttggagattttgcaaatgcggcgcaagtttac
tttgaccagttcatttctgcaggaagagcgaagtggggtcaaaaatcagggctggttgtt
ctcttgccgcacggctatgaagggcaggggcctgagcattcaagcggaagaacagagcga
ttccttcaattggcggcggaaaacaactggactgtcgccaacctgacgagcgctgcccaa
tactttcatattttaagaaggcaggcgaagatgctccttcgcgaggagatccgcccgctg
atcatcatgacgccgaaaagcctgctgagaaatccgaataccgtgtcagaagtgcaggag
ctcagtaacagcagctttaagccggtctatgaaatgtcaggactttcccatcaatatgac
aaagtgacgcgcctcgtcctttcaagcggcaaagtttcgattgacatcagcgaccatttc
aataaaatggaaggtgaaaaggattggctgcacattgcacgggttgaagagctgtatcct
ttccctgcaaagcatattaaagcgatcttcagcaaacttccgaatttggaggagatcgtc
tgggtacaggaagaaccgcaaaatatgggcgcatggaactatatcgagccttatttaaga
gaggtagctccaaaggacgtgaaggtccgctatattggcagaagaagacgttcaagtccg
gcagaaggggatccgacggttcataaaaaggaacaggaacgcattgtatctgatagcttg
actcgcaaaaattaa

DBGET integrated database retrieval system