KEGG   Brevibacterium linens SMQ-1335: BLSMQ_1212Help
Entry
BLSMQ_1212        CDS       T04775                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
blin  Brevibacterium linens SMQ-1335
Pathway
blin00010  Glycolysis / Gluconeogenesis
blin00030  Pentose phosphate pathway
blin00051  Fructose and mannose metabolism
blin00052  Galactose metabolism
blin00680  Methane metabolism
blin01100  Metabolic pathways
blin01110  Biosynthesis of secondary metabolites
blin01120  Microbial metabolism in diverse environments
blin01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:blin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLSMQ_1212
   00030 Pentose phosphate pathway
    BLSMQ_1212
   00051 Fructose and mannose metabolism
    BLSMQ_1212
   00052 Galactose metabolism
    BLSMQ_1212
  Energy metabolism
   00680 Methane metabolism
    BLSMQ_1212
Enzymes [BR:blin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BLSMQ_1212
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BLSMQ_1212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Arc
Motif
Other DBs
NCBI-ProteinID: AOP52922
UniProt: A0A1D7W1T7
LinkDB All DBs
Position
complement(1314090..1315115)
Genome map
AA seq 341 aa AA seqDB search
MKIGVLTSGGDCPGLNAVIRGIVRKGIRSHEDTFVGIRDGWRGLLEDDVFDMSMLDVRGL
SGRGGTILGTSRTHPYEGGGPERMREVMSAHGIDAIVAIGGEGTLAGAARLVHEEGLNII
GVPKTIDNDLSGTDYTFGFDSAHAIATESIDRLRTTAESHHRCMVIEVMGRNVGWIALHA
GMAGGAHAILMPEFPVSFDQIEEWVTSARDRGRAPIVVVAEGFIPEGLDEQVADRGVDNK
GRTRLGGIADFLAPKIEEITGIESRATILGHLQRGGSPTAYDRVLSTRLGMAAADLAHNG
DWGKMASLKGTDIVSVDMASAVDRLKSVPLQRWEEAQVLFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagataggtgtactgacctccggcggtgactgccccggactcaacgcggtcatccgc
ggaatcgtccgcaagggcattcgctcccacgaggatacgttcgtcggaatccgcgacggg
tggcgcggcctgctcgaagacgatgtgttcgacatgtcgatgctcgacgttcgtggactc
tccggccgcggcggaaccatcctcggcacttcgcgcacccacccctatgagggcggcggg
ccggagcggatgcgtgaggtgatgagcgcccacggcatcgacgcgatcgttgcgatcggc
ggcgagggaactctggccggtgccgcccgactcgtgcacgaagagggtctgaacatcatc
ggcgtcccgaagaccatcgacaacgatctcagcggcaccgactacaccttcggcttcgac
tcggcccatgccatcgcgaccgagtccatcgaccggctccgcacaacggcggagtcccac
caccggtgcatggtcatcgaggtcatgggccgcaacgtcgggtggatcgcactgcatgcg
ggaatggccggtggcgcccacgcgatcctcatgcccgagtttcccgtctccttcgaccag
atcgaagagtgggtgacctcggccagggaccgtggtcgtgccccgattgtcgtcgtggcc
gaaggcttcattcccgagggtctcgacgaacaggtcgccgaccgcggtgtcgacaacaag
ggccggacccgcctcggcggtattgcggacttcctggcgccaaagatcgaggagatcacg
ggaatcgaatcccgtgccaccatcctcggacacctgcagcgaggcggctcccccacggcc
tatgaccgggtcctgtccacgcgcctggggatggctgcggcagatctcgcgcacaacggc
gactggggcaagatggccagtctcaagggcaccgacatcgtctcggtcgacatggcctcg
gccgtcgatcgcctcaaatcagttccgctccagcgctgggaagaggctcaggtcctcttc
ggctag

DBGET integrated database retrieval system