KEGG   Brevibacterium linens SMQ-1335: BLSMQ_1369Help
Entry
BLSMQ_1369        CDS       T04775                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
blin  Brevibacterium linens SMQ-1335
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1476602..1477552
Genome map
AA seq 316 aa AA seqDB search
MSEAPRPALATLRHERFWDEEWVYERKLDGQRCLAVRDGGRTPHLYSRNGRDDSATFPEV
VTALTQQAGGSYVIDGEIVAFDGAATSFSRLQPRINLTDPTDIENSGIAVCFYVFDLLEL
EGEDLKDRPLVERKKKLFDLVDWTDPLRWTPHRNRGDEDWFREICGRGWEGLIAKRRDST
YPSGRTPDWLKFKCEAGQELVIVGFTEPQGQRVGLGALMLGYYDYSEDTKDLVYAGKVGT
GFSEDDLGELHEMLRAIEIPDSACTKGRIPREGHWVEPEHVAEVAFTEWTAENQLRHPRY
LGLRNDKRAEDVVKEA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggcaccgagaccagccctggcgacacttcgccacgagcgattctgggacgag
gagtgggtctatgagcgcaagctcgacggacagcgctgcttggcggttcgcgacggagga
aggacaccgcacctgtactcccgcaacggtcgagacgattccgcgacgttccctgaggtc
gtcaccgccctcacacagcaggcaggtggatcctatgtcatcgacggtgagatcgtggcg
ttcgacggggctgcgaccagcttctcccgactgcagcctcggatcaatctcactgatccc
accgacatcgagaactcgggaattgcggtctgcttctacgtcttcgacctcctcgagctt
gagggcgaagatctcaaggacaggccgctggtcgaacggaagaagaagctcttcgacctc
gtcgactggaccgatccgctgcgctggacaccgcatcgcaatcggggcgatgaggactgg
ttccgcgaaatctgtggcagaggatgggagggcctcatcgccaaacggcgcgattcgact
tatccctccggccggacgccggactggctgaagttcaaatgcgaggcgggccaggagctt
gtcatcgtcgggttcaccgagccgcaggggcagagggtcggactgggcgcgctcatgctc
ggctactacgactattcggaggacacgaaggatctcgtgtacgcgggaaaggtggggacc
gggttcagcgaggacgacctcggcgaactgcatgagatgctcagggcaatcgagatcccg
gactccgcgtgcaccaaaggccgcataccccgcgaggggcactgggtggaaccagaacac
gtcgccgaggtggccttcaccgaatggacggcggagaatcagctccgccaccccagatac
ctcggactgagaaacgacaaacgggcggaagacgtcgtcaaggaggcatga

DBGET integrated database retrieval system