KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0042Help
Entry
BLLJ_0042         CDS       T01419                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:blm00001]
   00620 Pyruvate metabolism
    BLLJ_0042
  Energy metabolism
   00680 Methane metabolism
    BLLJ_0042
Enzymes [BR:blm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BLLJ_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(49979..52732)
Genome map
AA seq 917 aa AA seqDB search
MATPEEQITPADAAIVTTGTGRKGPEEHDLPESLKYDMDLCLEILRNVLGEYNPELLSTF
DTVRHYAVEASAEHFAELKDPNPDQDGLKEAVNVIDNMTLHDAQLLARAFATYFHLANLS
EENYRVSVLHERENNVPVDQAVDPINELTVAYHQLINETGPAKAKELLNQLEFHPVFTAH
PTEARRKAVEGKIRRVSELLEEYKRLGGSDKKECLRRLYNEIDALFRTSPIALKKPTPVE
EADTILDIFDNTLFNTIPKVYRRFDDWVLGDKAGLVEPACPAFFHPGSWIGSDRDGNPNV
TAKVSRAVARKFSDHVIAALEQATRTVGRNLTMEAETTPPSAELKSLWSHQKEMSERLTD
KAALISTKEMHRAVMLVMADRLHYTIERDADLMYHSCDDFLADLKVVQRSLAAAGAKRSA
YGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALADIREHGLHGERGELQPMTHEVLDTF
RALGAIQKRNGLKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLED
LQNSVDVLEEMIKIPEVQARLKATGNKLEVMLGYSDSSKDAGPTSATLALHSAQERIAKW
AESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPVLA
IRHVESVAAATLLQSAPSVEKRNTEMTEKYADMAAQLDEAAHNRFLDLLNTDGFAPWFSI
VTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEKFGD
LETMRQAYEEWPLFSTFIDNIEMSIAKTDERIARMYLALGDREDLNEKVLNEMELTRKWV
LAIVGDKWPLQHRHVLGQAIRIRSPYVDALSVTQVLALKSLRKKVDKEELSQSQQAGFIY
LILCTVSGVAAGLQNTG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacctgaagaacagatcactcccgctgacgccgccatcgtcactaccgggacc
ggccgaaagggcccggaggagcatgatcttcccgaaagcctgaagtacgacatggatctg
tgtcttgagatcctgcgtaacgtactgggcgaatacaaccccgaactgctgtctacgttc
gacaccgtgcgtcattacgcggtggaggccagcgccgagcatttcgccgagctgaaggat
ccgaaccccgaccaggatggcctgaaggaggccgtgaacgtcatcgacaacatgacgttg
cacgacgcccagctgctggcccgcgcgttcgccacgtatttccatctggcaaacctgtcc
gaggagaactaccgcgtttccgtgctccacgagcgcgagaacaacgtgcccgttgaccag
gcggtcgacccgatcaacgagctcaccgtcgcctaccaccagctcatcaatgagactggc
ccggccaaggccaaggaactgctcaaccagctcgaattccaccccgtcttcacggcgcac
cccactgaggcccgtcgcaaggccgtggaaggcaagattcgccgcgtttccgaattgctt
gaggagtacaagcgcctcggcggctcggataagaaggaatgcctgcgccgtctctacaac
gagatcgacgccctgttccgcacctctccgatcgcgctgaagaagccgaccccggttgag
gaagcggacacgattctcgacatcttcgacaacacgctgttcaacaccatccccaaggtc
taccgtcgcttcgacgactgggtcctgggcgataaggccggtctcgtcgagcccgcttgc
cccgcgttcttccacccgggcagctggatcggctccgaccgcgacggtaacccgaacgtc
accgccaaggtgagccgcgccgtggcccgcaagttctccgatcacgtgatcgccgccctt
gagcaagccacccgcaccgtgggccgcaacctcacgatggaagccgagaccacgccgccg
agcgccgagctcaagagcctctggagccaccagaaggaaatgagcgagcgcctgaccgac
aaggccgccctgatctccaccaaggagatgcaccgcgcggtcatgctggtgatggccgat
cgtctgcactacaccatcgagcgcgacgccgacctcatgtaccactcctgcgacgacttc
ctcgccgacctcaaggtggtccagcgttcgctggccgccgccggtgccaagcgttccgct
tacggcccgctgcaggatctgatctggcagaccgagaccttcggcttccacatggtggag
atggagttccgtcagcactccgtggtgcacgcccgcgcccttgcggatatccgcgagcac
ggcctgcacggcgagcgcggcgaactgcagccgatgacgcacgaggtgctcgacaccttc
cgcgccctcggtgccatccagaagcgcaacggcctcaaggccgcccgccgctacatcatc
tccttcaccaagagcgcccagaacatcaaggatgtctacgagctcaaccgcttggccttc
tcccacccggaggacgtgcccaccatcgacgtgatcccgctgttcgagcagcttgaggat
ctgcagaactcggtggacgtgctcgaggaaatgatcaagatccccgaggttcaggctcgt
ctgaaggccaccggcaacaagctcgaggtcatgctcggctactccgactcctcgaaggac
gccggcccgacctccgccacgctggccctgcactccgctcaggagcgcatcgccaaatgg
gctgagtcgcacgacatcgacctgaccctgttccatggccgcggcggtgccgtcggtcgt
ggcggcggccccgccaaccgcgcggtgctcgcccagccggtcggttccgtcaagtgccgc
ttcaagctcaccgagcagggcgaggtcatcttcgcccgttacggcaacccggtgctggcc
atccgccacgtcgagtccgtggctgcggcgaccttgctgcagtccgcgccgagcgtggag
aagcgcaacaccgagatgaccgagaagtatgccgacatggccgctcagctcgacgaggcc
gcgcacaaccgcttcctcgacctgttgaacaccgacggctttgccccgtggttctcgatc
gttacgccgctgaccgaaatcggcctgctgccgatcggctcccgcccggccaagcgtggc
ctcggcgccaagtcgctcgacgacctgcgcacgattccgtggatcttctcctgggctcag
gcccgcatcaacctggccgcctggtacggtctcggcaccgcatgcgagaagttcggcgat
ctggagaccatgcgtcaggcttacgaggaatggccgctgttctccaccttcatcgacaac
atcgagatgtccatcgccaagacggatgagcgcatcgccaggatgtaccttgccctcggc
gaccgcgaggacctcaatgagaaggtactcaacgagatggagctcacccgcaagtgggtt
ctggccatcgtgggcgacaagtggccgctgcagcaccgtcacgtgctcggccaggccatc
cgcatccgctccccatacgtggacgcgctgtccgtcactcaggtgctggcgctcaagtcg
ctgcgcaagaaggtggacaaggaagagctctcgcaaagccaacaggccggattcatctac
ctcatcctgtgcaccgtctccggcgtcgccgcgggcctgcagaacacgggctga

DBGET integrated database retrieval system