KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0070Help
Entry
Balat_0070        CDS       T00924                                 

Definition
(GenBank) hypothetical protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Balat_0070
  Energy metabolism
   00680 Methane metabolism
    Balat_0070
Enzymes [BR:blt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Balat_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(74259..77015)
Genome map
AA seq 918 aa AA seqDB search
MTDQEQTITPADATIVSSGLGTKGPEERTLPATLQEDMDLCLNILRQVLSEYDENLLKTF
DTVRQYAVDASAERFSGVLTDTHPERDDLEMAVKTIDAMNLHDAQLLARAFATYFHLANL
CEENYRVAVLHEREAKVDDTQAIDPVNEMTKAYHQLISEMGPAKAKELLERLEFHPVFTA
HPTEARRKAVEGKIRRIAQLLEAHRLLGGSDKKEDSRRLYSEIDALFRTSPIALKKPTPV
EEADTILDIFDNTLFHTIPMVYRRFDDWMLGDKAGIEPPACPAFFHPGSWIGSDRDGNPN
VTAKVSRQVARKFSDHVLAALEEATRTVGRNMTVESETTPPSDELRALWNQQKEISERLT
GKASLISTKELHRAVLLVMADRLHYTIKRDTDLMYHNCDDFLADLRVVQRSLAEAGDKRA
AYGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALDDIREHGLHGERGPLQPMTHEVLDT
FRALGAIQKRNGVKAARRYIISFTKSAKNVRDVYELNRLAFSNPDDAPVIDVIPLFEQLE
DLEHSVSVLDEMLKIPEVQARLKQTGRKMEVMLGYSDSSKDAGPTTATLALHSAQERIAK
WADENDIDLTLFHGRGGAVGRGGGPANRAVLAQPKGSVKCRFKLTEQGEVIFARYGNPVL
AIRHVESVAAATLLQSAPSVEKTNTEMTEKYKPMANQLSEVSHETFLDLLNSEDFAPWFS
IVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGSACESFG
DLATLRKAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLALGDRPDLSKKVLDEMELTRKW
VLKIVGDEWPLQHRHVLGQAIRIRSPYVDALSVTQVLALRSLRKKVDKEELSESQQAGFI
YLILCTVSGVAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcaagagcaaacgatcacgccggccgacgccacgatcgtgtcgtccgggctc
ggcaccaaaggtcccgaagagcgcacgcttcccgcgacattgcaggaagacatggacttg
tgtctgaacattctgcgccaggtgctttccgaatacgacgagaatcttctcaaaacgttt
gacaccgtgcgtcagtatgccgtcgatgccagtgccgagcggttctccggcgtgctcacc
gacacgcatcccgaacgagacgacctagagatggccgtcaagacgatcgatgcgatgaat
ctgcacgatgctcagctgctcgcccgcgcgttcgccacgtacttccacctggcgaatctg
tgcgaggagaactaccgtgtggccgtgctccatgagcgcgaggccaaggtcgacgacacc
caggccatcgatccggtgaacgagatgacgaaggcctaccaccagctcatctccgaaatg
ggtccggccaaggccaaggagctgctcgaacgcctcgaattccacccggtgttcactgca
caccccaccgaggcgcgccgcaaggccgtggaaggcaagatccgccgcatcgcacagctg
ctcgaagcgcaccgtctgctcggcggctccgacaagaaggaggacagccgtcgcctgtac
agcgagatcgacgcactgttccgcacgtcgccgattgcgctgaagaagccgacgcctgtc
gaagaggccgacacgattctcgacatcttcgacaacacgctgttccacacgattccgatg
gtctaccgtcgtttcgacgactggatgctcggcgacaaggcaggcatcgagccgccggca
tgccccgcgttcttccacccgggcagctggatcggttccgaccgcgacggcaacccgaac
gtcaccgccaaggtgagccgtcaggtggcccgcaagttcagcgaccatgtgctcgccgcg
ctcgaggaggccacgcgcaccgtcggccgcaacatgaccgtcgaatccgagaccacgcca
ccgagcgacgaactgcgcgcgctgtggaaccagcagaaggagatcagcgagcgactcacc
ggcaaggcatcgctcatctccacgaaggagctgcatcgcgcggtgctgctcgtcatggcc
gaccgcctgcattacacgatcaagcgcgacaccgatctcatgtaccacaactgcgacgac
ttcctcgcggatcttcgcgtggtgcagcgttcgctcgccgaggccggcgacaaacgcgcc
gcctatggcccgctgcaggacctcatctggcagaccgagaccttcggcttccacatggtc
gaaatggagttccgccagcattcggtggtgcatgcgcgcgccctcgacgacattcgcgag
cacggcctgcatggcgaacgcggaccgttgcagccgatgacgcatgaggtgctcgacacc
ttccgtgccctcggcgcgatccagaagcgcaatggcgtcaaggccgcgcgccgctacatc
atctcgttcacgaagagcgcgaagaacgtgcgcgacgtgtacgagctcaaccgtctggcg
ttctcgaatccggacgacgccccggtgatcgacgtgatcccgctgttcgaacagctcgag
gatctcgagcattcggtctcggtgctcgacgagatgctgaagattcccgaggtgcaggcc
cgactcaagcagaccggccgcaagatggaggtcatgctcggctactcggattcgtcgaag
gatgccggccccaccaccgccacgctcgcgctgcactccgcgcaggagcgcattgcgaag
tgggcggacgagaacgacatcgatctgacgctgttccacggccgcggcggcgccgtcggt
cgtggcggtggcccggccaaccgcgcggtgctcgcacagccgaagggttcggtcaagtgc
cgcttcaagctcaccgagcagggcgaggtcatcttcgcccgctacggcaatccggtactc
gccatccgacacgtcgagtccgtggccgccgcgacgctgttgcagtcggctccgagcgtg
gagaagacgaacaccgagatgaccgagaagtacaagccaatggcgaatcagctcagcgaa
gtttcacatgaaacgttccttgatctgctcaacagcgaggacttcgcgccatggttctcg
atcgtcacgccgttgaccgagatcggcttgctgccgatcggttcccgccctgcgaagcgc
ggcttgggagccaagtcgctcgacgatctgcgtacgatcccgtggatcttctcgtgggcc
caggcccgcatcaacctcgccgcctggtatggcctcggctccgcatgcgagtcgttcggc
gacctcgccacgctgcgcaaggcatacgaggaatggccgctgttctccacgttcatcgac
aacatcgagatgtcgctggcgaagaccgacgaacgcatcgcgaagatgtaccttgcactc
ggcgaccgcccggacctctcgaagaaggtgctcgacgagatggaactcacacgcaagtgg
gtgctcaagatcgtcggcgacgaatggccgctgcagcaccgtcatgtgcttggccaggcg
attcgcatccgctccccgtacgtcgacgcactgtccgtcacgcaggtgctcgcattgcgt
tcgctgcgtaagaaggtcgacaaggaggagctctccgaaagccagcaggcaggattcatc
tacctgatcctctgcaccgtttcgggtgtcgccgccggcctgcagaacaccggctga

DBGET integrated database retrieval system