KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0070Help
Entry
Balat_0070        CDS       T00924                                 

Definition
(GenBank) hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
blt00620  Pyruvate metabolism
blt00680  Methane metabolism
blt01100  Metabolic pathways
blt01120  Microbial metabolism in diverse environments
blt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Balat_0070
  Energy metabolism
   00680 Methane metabolism
    Balat_0070
Enzymes [BR:blt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Balat_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACS47033
LinkDB All DBs
Position
complement(74259..77015)
Genome map
AA seq 918 aa AA seqDB search
MTDQEQTITPADATIVSSGLGTKGPEERTLPATLQEDMDLCLNILRQVLSEYDENLLKTF
DTVRQYAVDASAERFSGVLTDTHPERDDLEMAVKTIDAMNLHDAQLLARAFATYFHLANL
CEENYRVAVLHEREAKVDDTQAIDPVNEMTKAYHQLISEMGPAKAKELLERLEFHPVFTA
HPTEARRKAVEGKIRRIAQLLEAHRLLGGSDKKEDSRRLYSEIDALFRTSPIALKKPTPV
EEADTILDIFDNTLFHTIPMVYRRFDDWMLGDKAGIEPPACPAFFHPGSWIGSDRDGNPN
VTAKVSRQVARKFSDHVLAALEEATRTVGRNMTVESETTPPSDELRALWNQQKEISERLT
GKASLISTKELHRAVLLVMADRLHYTIKRDTDLMYHNCDDFLADLRVVQRSLAEAGDKRA
AYGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALDDIREHGLHGERGPLQPMTHEVLDT
FRALGAIQKRNGVKAARRYIISFTKSAKNVRDVYELNRLAFSNPDDAPVIDVIPLFEQLE
DLEHSVSVLDEMLKIPEVQARLKQTGRKMEVMLGYSDSSKDAGPTTATLALHSAQERIAK
WADENDIDLTLFHGRGGAVGRGGGPANRAVLAQPKGSVKCRFKLTEQGEVIFARYGNPVL
AIRHVESVAAATLLQSAPSVEKTNTEMTEKYKPMANQLSEVSHETFLDLLNSEDFAPWFS
IVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGSACESFG
DLATLRKAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLALGDRPDLSKKVLDEMELTRKW
VLKIVGDEWPLQHRHVLGQAIRIRSPYVDALSVTQVLALRSLRKKVDKEELSESQQAGFI
YLILCTVSGVAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcaagagcaaacgatcacgccggccgacgccacgatcgtgtcgtccgggctc
ggcaccaaaggtcccgaagagcgcacgcttcccgcgacattgcaggaagacatggacttg
tgtctgaacattctgcgccaggtgctttccgaatacgacgagaatcttctcaaaacgttt
gacaccgtgcgtcagtatgccgtcgatgccagtgccgagcggttctccggcgtgctcacc
gacacgcatcccgaacgagacgacctagagatggccgtcaagacgatcgatgcgatgaat
ctgcacgatgctcagctgctcgcccgcgcgttcgccacgtacttccacctggcgaatctg
tgcgaggagaactaccgtgtggccgtgctccatgagcgcgaggccaaggtcgacgacacc
caggccatcgatccggtgaacgagatgacgaaggcctaccaccagctcatctccgaaatg
ggtccggccaaggccaaggagctgctcgaacgcctcgaattccacccggtgttcactgca
caccccaccgaggcgcgccgcaaggccgtggaaggcaagatccgccgcatcgcacagctg
ctcgaagcgcaccgtctgctcggcggctccgacaagaaggaggacagccgtcgcctgtac
agcgagatcgacgcactgttccgcacgtcgccgattgcgctgaagaagccgacgcctgtc
gaagaggccgacacgattctcgacatcttcgacaacacgctgttccacacgattccgatg
gtctaccgtcgtttcgacgactggatgctcggcgacaaggcaggcatcgagccgccggca
tgccccgcgttcttccacccgggcagctggatcggttccgaccgcgacggcaacccgaac
gtcaccgccaaggtgagccgtcaggtggcccgcaagttcagcgaccatgtgctcgccgcg
ctcgaggaggccacgcgcaccgtcggccgcaacatgaccgtcgaatccgagaccacgcca
ccgagcgacgaactgcgcgcgctgtggaaccagcagaaggagatcagcgagcgactcacc
ggcaaggcatcgctcatctccacgaaggagctgcatcgcgcggtgctgctcgtcatggcc
gaccgcctgcattacacgatcaagcgcgacaccgatctcatgtaccacaactgcgacgac
ttcctcgcggatcttcgcgtggtgcagcgttcgctcgccgaggccggcgacaaacgcgcc
gcctatggcccgctgcaggacctcatctggcagaccgagaccttcggcttccacatggtc
gaaatggagttccgccagcattcggtggtgcatgcgcgcgccctcgacgacattcgcgag
cacggcctgcatggcgaacgcggaccgttgcagccgatgacgcatgaggtgctcgacacc
ttccgtgccctcggcgcgatccagaagcgcaatggcgtcaaggccgcgcgccgctacatc
atctcgttcacgaagagcgcgaagaacgtgcgcgacgtgtacgagctcaaccgtctggcg
ttctcgaatccggacgacgccccggtgatcgacgtgatcccgctgttcgaacagctcgag
gatctcgagcattcggtctcggtgctcgacgagatgctgaagattcccgaggtgcaggcc
cgactcaagcagaccggccgcaagatggaggtcatgctcggctactcggattcgtcgaag
gatgccggccccaccaccgccacgctcgcgctgcactccgcgcaggagcgcattgcgaag
tgggcggacgagaacgacatcgatctgacgctgttccacggccgcggcggcgccgtcggt
cgtggcggtggcccggccaaccgcgcggtgctcgcacagccgaagggttcggtcaagtgc
cgcttcaagctcaccgagcagggcgaggtcatcttcgcccgctacggcaatccggtactc
gccatccgacacgtcgagtccgtggccgccgcgacgctgttgcagtcggctccgagcgtg
gagaagacgaacaccgagatgaccgagaagtacaagccaatggcgaatcagctcagcgaa
gtttcacatgaaacgttccttgatctgctcaacagcgaggacttcgcgccatggttctcg
atcgtcacgccgttgaccgagatcggcttgctgccgatcggttcccgccctgcgaagcgc
ggcttgggagccaagtcgctcgacgatctgcgtacgatcccgtggatcttctcgtgggcc
caggcccgcatcaacctcgccgcctggtatggcctcggctccgcatgcgagtcgttcggc
gacctcgccacgctgcgcaaggcatacgaggaatggccgctgttctccacgttcatcgac
aacatcgagatgtcgctggcgaagaccgacgaacgcatcgcgaagatgtaccttgcactc
ggcgaccgcccggacctctcgaagaaggtgctcgacgagatggaactcacacgcaagtgg
gtgctcaagatcgtcggcgacgaatggccgctgcagcaccgtcatgtgcttggccaggcg
attcgcatccgctccccgtacgtcgacgcactgtccgtcacgcaggtgctcgcattgcgt
tcgctgcgtaagaaggtcgacaaggaggagctctccgaaagccagcaggcaggattcatc
tacctgatcctctgcaccgtttcgggtgtcgccgccggcctgcagaacaccggctga

DBGET integrated database retrieval system