KEGG   Burkholderia mallei ATCC 23344: BMAA1016Help
Entry
BMAA1016          CDS       T00204                                 

Definition
(RefSeq) AMP-binding protein
Organism
bma  Burkholderia mallei ATCC 23344
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:1042848..1044647
Genome map
AA seq 599 aa AA seqDB search
MPSNFAEHFENQVLKYGNRSQFVFLHGKPGDSAGEARLGYAQLDARARSIAAWLSACGAA
RRPVLLVYPEGLAFVAAFLGCLYAGAIAVPVPVPADARSVERTRRIVRDAGIALALTPTA
ADAHALANCLAAPGDAVSTVGALRCEATDALEALDASAWSRPALDASAIAFLQYTSGSTG
EPKGVVVSHRNLLHNEAQIQRVVASDADSVVTGWLPHFHDMGLIGMLLHPLYVGCDCVFM
APSTFLRRPVRWLEAATHYAATITVAPNFAYDLCARAVKREQLGGLDLSALKVALNGAEP
VRAKTIEAFSARFAPVGFDARAFSPCYGMAEVTLLASAGRPAAAPVLLDIDARALERHEA
SLAKPGAEALRVVGSGRAVDLDLRIVDPQTHAVAADGRIGEIWLRGDSVAQGYWRRPDAS
EAAFRARTAAGDGPYLRTGDLGFVRDGELFVTGRLKDLLIVNGRNLYPQDIEDFVRELHP
ALGAGAGAAFSIDADGERVVVVHEIKEAWLDDGLSAAALSARIRTALARAFDIAAPSVVL
VPRGGVKRTTSGKVQRGLTRDAFLAARLRVLHEDIQVPVRSLRVAAGEGVAQDASRGAA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtctaattttgccgaacacttcgaaaatcaagtcttgaagtatgggaatcgcagt
caatttgtttttctacacggaaaacccggtgattcggccggcgaggcgcggctcggctat
gcgcaactggatgcccgcgcgcgatcgatcgccgcgtggctgtcggcgtgcggcgccgcg
cgccggccggttctgctcgtctatcccgaaggcctcgcgtttgtggcggcttttctcggc
tgcctgtatgccggcgcgatcgccgtgccggtgcccgtgcccgcggacgcgcgcagcgtc
gagcgaaccaggcggatcgtccgcgatgcgggcatcgcgcttgcgctgacgccgacggcc
gccgatgcgcacgcgctcgcgaactgcctggctgcgcccggcgatgcggtctccacggtc
ggcgcgctgcgatgcgaggccaccgacgcgctcgaggccctcgatgcgagcgcgtggagc
aggccggcgctcgatgcctcggcgatcgcgttcttgcaatacacgtccggctcgacggga
gagcccaaaggcgtcgtcgtgtcgcatcgtaatctgctgcacaacgaagcgcagattcag
cgtgtcgtggcgagcgacgccgatagcgtcgtgacgggatggctgccgcattttcacgac
atggggctgatcggcatgctgctgcatccgctgtacgtcggctgcgactgcgtgttcatg
gcgccgtccacgttcttgcggcgtcccgttcgatggctggaggccgcgacgcattacgcg
gccacgattacggtcgcgccgaacttcgcgtacgacctgtgcgcgcgcgccgtgaagcgc
gagcaactcggcgggctcgatctgtccgcgctgaaggtcgcgttgaacggcgcggagccg
gttcgcgcgaaaacgatcgaagcgttctcggcgcgtttcgcgccggtcggcttcgatgca
cgggcgttttcgccgtgctacgggatggccgaggtcacgttgctcgcgagcgcgggccgc
ccggcggcggcgcccgtgctgctcgatatcgacgcgcgggcgctcgagcgccatgaggca
tcgttggcgaagcccggtgccgaggcgttgcgcgtcgtgggcagtgggcgcgccgtcgat
ctcgatctgcgcatcgtcgatccgcaaacgcacgccgtggcggccgacgggcgcatcggc
gagatctggctgcgcggcgacagcgtcgcgcaaggctactggcgccgccccgacgcgagc
gaggcggcgttccgggcgcgcacggccgcaggcgacgggccgtatctgcggaccggcgat
ctcggtttcgtgcgggacggggagctgttcgtgaccgggcgcctcaaggacctgctgatc
gtcaacggccgcaacctctatccgcaggacatcgaggatttcgttcgcgagttgcatccc
gcgctcggcgcgggcgcgggcgcggcgttttcgatcgatgcggacggcgaacgcgtcgtc
gtcgtccatgaaatcaaggaggcgtggctcgacgatggcctttcggccgccgcgctgtcc
gctcgcatcaggacggcgctcgcgcgcgcgttcgacatcgcggccccgagcgtcgtgctc
gtgccgcgcggcggcgtgaagcgcacgacgagcggcaaggtgcagcgcggcctcacgcgc
gacgcgtttctggccgcgcggctgcgcgtgctgcacgaggatatccaggtgccggttcgg
tcgttgcgtgtggccgcgggcgagggcgtcgcgcaggatgcctcccggggcgccgcatga

DBGET integrated database retrieval system