KEGG   Burkholderia mallei 6: DM78_2083Help
Entry
DM78_2083         CDS       T03489                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bmae  Burkholderia mallei 6
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bmae00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM78_2083
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DM78_2083
   00680 Methane metabolism
    DM78_2083
Enzymes [BR:bmae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DM78_2083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:2325860..2328844
Genome map
AA seq 994 aa AA seqDB search
MKSSGSARATRRNAVSSSSAPAHAEPPARRAAKPARKLDGAAARPLAPTNAASAKPQGRT
REDKDRPLFEDIRYLGRLLGDVVREQEGDAVFDVVETIRQTAVKFRREDDKAAAQTLEKM
LRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAAQAGTVAYALDKLKQA
GDASSKTIKQFFEGALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTARELAHNE
ALLRARVTTLWQTRMLRDARLTVADEIENALSYYRATFLDELPALYADIEEALAEHGLRA
RVPAFFQMGSWIGGDRDGNPNVTAATLDEAISRQAAVIFEHYLEQVHKLGAELSVSNLLV
GASDALKALAAASPDQSPHRVDEPYRRALIGVYTRLAASARVRLGEGTVPVRSAGRGAAP
VRATPYADAEEFAADLRVLTDSLALHHGESLATPRLAPLMRAAEVFGFHLASIDLRQSSD
IHEAVVAELLARGGVEADYAALPEADKLRVLLAALADPRPLRSPYLDYSDLAKSELGVLE
RAHAIRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLFEGTLGTPHANARNGLMVIP
LFETIADLRNASDIMRAFFALPGVGELLAHQGHEQEVMLGYSDSNKDGGFLTSNWELYRA
ELALVDLFDERGIKLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEVIASK
FANPEIGRRNLETVVAATLEATLAPHSNAPKQLPAFEAAMQTLSDAAMASYRALVYETPG
FTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRKIEDLRAIPWGFSWGQCRLLLTGWYG
FGSAVAAYLDGAPDAAERGKRVALLKKMNKTWPFFANLLSNMDMVLAKTDLAVASRYAQL
VADKKLRKHVFERIVAEWHRTADALAEITGAHARLAANPLLARSIKNRFPYLDPLNHLQV
ELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgcgcgacgcgccgcaatgctgtctcgtcctcttccgcc
ccggcgcacgccgagccccccgcccgccgcgccgcaaaacccgcacgcaagctcgacggc
gccgccgcgcgcccgctcgcgccgacgaacgccgcatccgcgaaaccgcagggccgcacg
cgcgaagacaaggaccgcccgctcttcgaggacattcgctatctcggccgcctgctcggc
gacgtcgttcgcgaacaggaaggcgacgccgtgttcgacgtcgtcgagacgattcgccag
accgcggtcaagttccgccgcgaggacgacaaggctgccgcgcagacgctcgagaaaatg
ctgcgcaagctcacgcccgagcagacggtgagcgtcgtgcgcgcgttcagctatttctcg
cacctcgcgaacatcgccgaggaccgccatcacaaccgccgccgccgcatccacgcgctc
gcgggctccgcggcgcaggcgggcaccgtcgcgtacgcgctcgacaagctcaagcaggcg
ggcgacgcgtcgtcgaagacgatcaagcagttcttcgaaggcgcgctgatcgtgcccgtg
ctcaccgcgcacccgaccgaggtgcagcgcaagagcattctcgacgcgcagcacgacatc
gcgcggctgctcgccgagcgcgaccagccgctgaccgcgcgcgagctcgcgcacaacgag
gcgctgctgcgcgcgcgcgtgacgacgctctggcagacccggatgctgcgcgacgcgcgc
ctgaccgtcgccgacgagatcgagaacgcgctgtcgtactaccgcgcgacgttcctcgac
gagctgcccgcgctctacgcggacatcgaggaggcgctcgccgagcacggcctgcgcgcg
cgcgtgccggcgttcttccagatgggcagctggatcggcggcgaccgcgacggcaacccg
aacgtcaccgccgcgacgctcgacgaggcgatcagccgccaggcggcggtgatcttcgag
cattacctcgaacaggtgcacaagctcggcgcggagttgtccgtgtcgaacctgctcgtc
ggcgcgagcgacgcgctcaaggcgctcgccgccgcgtcgccggaccagtcgccgcaccgc
gtcgacgagccgtaccgccgcgcgctgatcggcgtctacacgcggctcgcggccagcgcg
cgcgtgcggctcggcgagggcacggtgcccgtgcgcagcgcgggccgcggcgccgcgccc
gtgcgcgcgacgccgtacgcggacgcggaggagttcgccgccgatctgcgcgtgctgacc
gattcgctcgcgctgcatcacggcgaatcgctcgcgacgccgcgcctcgcgccgctcatg
cgcgcggccgaggtgttcggcttccatctcgcgagcatcgatttgcggcagagctcggac
atccatgaagcggtggtcgccgaactgctcgcgcgcggcggcgtcgaggccgactacgcg
gcgctgcccgaagcggacaagctgcgcgtgctgctcgcggcgctcgcggacccgcggccg
ctgcgctcgccgtatctcgactactcggacctcgcgaaaagcgagctcggcgtgctcgag
cgcgcgcacgcgatccgcgcgcagttcggcgcacgcgcggtgcgcaactacatcatttcg
cataccgagacagtgagcgatctcgtcgaggtgctgctgctgcagaaggaaacgggcctc
ttcgagggcacgctcggcacgccgcacgcgaacgcgcgcaacggcctgatggtgattccg
ctcttcgagacgatcgccgacctgcgcaacgcgtccgacatcatgcgcgcgttcttcgcg
ctgccgggcgtgggcgagctgctcgcgcaccagggccacgagcaggaagtgatgctcggc
tattcggacagcaacaaggacggcggcttcctcacgtcgaactgggagctctatcgcgcg
gaactggcgctcgtcgatctgttcgacgagcgcgggatcaagctgcgcctgttccacggc
cgcggcggcacggtgggacgcggcggcggcccgacctatcaggcgatcctgtcgcagccg
cccggcacggtaaacggccagatccggctcaccgagcagggcgaggtgatcgcgagcaag
ttcgcgaacccggagatcggccggcgcaatctggagacggtcgtcgccgcgacgctcgag
gcgacgctcgcgccgcacagcaacgcgccgaagcagttgcccgcgttcgaggcggcgatg
cagacgctgtcggacgcggcgatggcgtcgtaccgcgcgctcgtctacgagacgcccggc
ttcaccgactacttcttctcgtcgacgccgatcaccgagatcgccgagctgaacatcggc
agccggcccgcgtcgcgcaagctgcaggatccgaagaaccgcaagatcgaggacctgcgc
gcgattccgtggggcttctcatggggccagtgccggctgctgctcaccggctggtacggc
ttcggcagcgcggtcgccgcgtatctcgacggcgcgccggacgcggccgagcgcggcaag
cgcgtcgcgctgctgaagaaaatgaacaagacctggccgttcttcgcgaacctgctgtcg
aacatggacatggtgctcgcgaagaccgatctcgcggttgcgtcgcgctacgcgcagctc
gtcgccgacaagaagctgcgcaagcacgtgttcgagcggatcgtcgccgaatggcatcgc
acggcggatgcgctcgccgagatcaccggcgcgcacgcgcggctcgccgcgaatccgctt
ctcgcgcgctcgatcaagaaccgcttcccgtacctcgatccgctgaaccacctgcaagtc
gagctgatcaagcggcaccgcgcgggcgacacgaacgcgcggctgcggcgcgggatccat
ctgacgatcaacgggatcgcggccggcctgcgcaatacgggctga

DBGET integrated database retrieval system