KEGG   Burkholderia mallei FMH 23344: DM51_4695Help
Entry
DM51_4695         CDS       T03523                                 

Definition
(GenBank) AMP-binding enzyme family protein
Organism
bmaf  Burkholderia mallei FMH 23344
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:1782259..1784019
Genome map
AA seq 586 aa AA seqDB search
MKYGNRSQFVFLHGKPGDSAGEARLGYAQLDARARSIAAWLSACGAARRPVLLVYPEGLA
FVAAFLGCLYAGAIAVPVPVPADARSVERTRRIVRDAGIALALTPTAADAHALANCLAAP
GDAVSTVGALRCEATDALEALDASAWSRPALDASAIAFLQYTSGSTGEPKGVVVSHRNLL
HNEAQIQRVVASDADSVVTGWLPHFHDMGLIGMLLHPLYVGCDCVFMAPSTFLRRPVRWL
EAATHYAATITVAPNFAYDLCARAVKREQLGGLDLSALKVALNGAEPVRAKTIEAFSARF
APVGFDARAFSPCYGMAEVTLLASAGRPAAAPVLLDIDARALERHEASLAKPGAEALRVV
GSGRAVDLDLRIVDPQTHAVAADGRIGEIWLRGDSVAQGYWRRPDASEAAFRARTAAGDG
PYLRTGDLGFVRDGELFVTGRLKDLLIVNGRNLYPQDIEDFVRELHPALGAGAGAAFSID
ADGERVVVVHEIKEAWLDDGLSAAALSARIRTALARAFDIAAPSVVLVPRGGVKRTTSGK
VQRGLTRDAFLAARLRVLHEDIQVPVRSLRVAAGEGVAQDASRGAA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtatgggaatcgcagtcaatttgtttttctacacggaaaacccggtgattcggcc
ggcgaggcgcggctcggctatgcgcaactggatgcccgcgcgcgatcgatcgccgcgtgg
ctgtcggcgtgcggcgccgcgcgccggccggttctgctcgtctatcccgaaggcctcgcg
tttgtggcggcttttctcggctgcctgtatgccggcgcgatcgccgtgccggtgcccgtg
cccgcggacgcgcgcagcgtcgagcgaaccaggcggatcgtccgcgatgcgggcatcgcg
cttgcgctgacgccgacggccgccgatgcgcacgcgctcgcgaactgcctggctgcgccc
ggcgatgcggtctccacggtcggcgcgctgcgatgcgaggccaccgacgcgctcgaggcc
ctcgatgcgagcgcgtggagcaggccggcgctcgatgcctcggcgatcgcgttcttgcaa
tacacgtccggctcgacgggagagcccaaaggcgtcgtcgtgtcgcatcgtaatctgctg
cacaacgaagcgcagattcagcgtgtcgtggcgagcgacgccgatagcgtcgtgacggga
tggctgccgcattttcacgacatggggctgatcggcatgctgctgcatccgctgtacgtc
ggctgcgactgcgtgttcatggcgccgtccacgttcttgcggcgtcccgttcgatggctg
gaggccgcgacgcattacgcggccacgattacggtcgcgccgaacttcgcgtacgacctg
tgcgcgcgcgccgtgaagcgcgagcaactcggcgggctcgatctgtccgcgctgaaggtc
gcgttgaacggcgcggagccggttcgcgcgaaaacgatcgaagcgttctcggcgcgtttc
gcgccggtcggcttcgatgcacgggcgttttcgccgtgctacgggatggccgaggtcacg
ttgctcgcgagcgcgggccgcccggcggcggcgcccgtgctgctcgatatcgacgcgcgg
gcgctcgagcgccatgaggcatcgttggcgaagcccggtgccgaggcgttgcgcgtcgtg
ggcagtgggcgcgccgtcgatctcgatctgcgcatcgtcgatccgcaaacgcacgccgtg
gcggccgacgggcgcatcggcgagatctggctgcgcggcgacagcgtcgcgcaaggctac
tggcgccgccccgacgcgagcgaggcggcgttccgggcgcgcacggccgcaggcgacggg
ccgtatctgcggaccggcgatctcggtttcgtgcgggacggggagctgttcgtgaccggg
cgcctcaaggacctgctgatcgtcaacggccgcaacctctatccgcaggacatcgaggat
ttcgttcgcgagttgcatcccgcgctcggcgcgggcgcgggcgcggcgttttcgatcgat
gcggacggcgaacgcgtcgtcgtcgtccatgaaatcaaggaggcgtggctcgacgatggc
ctttcggccgccgcgctgtccgctcgcatcaggacggcgctcgcgcgcgcgttcgacatc
gcggccccgagcgtcgtgctcgtgccgcgcggcggcgtgaagcgcacgacgagcggcaag
gtgcagcgcggcctcacgcgcgacgcgtttctggccgcgcggctgcgcgtgctgcacgag
gatatccaggtgccggttcggtcgttgcgtgtggccgcgggcgagggcgtcgcgcaggat
gcctcccggggcgccgcatga

DBGET integrated database retrieval system